KEGG   Oceanobacillus iheyensis: OB0946Help
Entry
OB0946            CDS       T00093                                 

Definition
(GenBank) malate:quinone oxidoreductase
  KO
K00116  malate dehydrogenase (quinone) [EC:1.1.5.4]
Organism
oih  Oceanobacillus iheyensis
Pathway
oih00020  Citrate cycle (TCA cycle)
oih00620  Pyruvate metabolism
oih01100  Metabolic pathways
oih01110  Biosynthesis of secondary metabolites
oih01120  Microbial metabolism in diverse environments
oih01130  Biosynthesis of antibiotics
oih01200  Carbon metabolism
Module
oih_M00009  Citrate cycle (TCA cycle, Krebs cycle)
oih_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:oih00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    OB0946
   00620 Pyruvate metabolism
    OB0946
Enzymes [BR:oih01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.4  malate dehydrogenase (quinone)
     OB0946
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mqo DAO K_oxygenase HI0933_like Pyr_redox_2 Pyr_redox NAD_binding_8
Motif
Other DBs
NCBI-ProteinID: BAC12902
JAMSTEC: OB0946
UniProt: Q8CV11
Position
992340..993848
Genome map
AA seq 502 aa AA seqDB search
MSNKHTQADVILIGAGIMSATLGSLLKELSPNLEIRVFEKLENPGEESSNEWNNAGTGHS
ALCELNYTSERTDGSIDINKAVKVNEQFQLSRQFWSYLVNRNLIRNPEDFIRALPHISLV
QGEDNVTFLRKRFKALVNHPLFNGMEFSDDNEKLKEWMPLIMDKRDTNEPIAATKIDSGT
DVNFGALTRLLFQEFDHKGIDVNYNHSVEDIKRNSEGLWEVKVHDMNDEKIEYHTAKFVF
IGAGGGSLPLLQKTGIKESKHIGGFPVSGLFMVCNNPEVIEQHHAKVYGKAKVGAPPMSV
PHLDTRFIDGKKSLLFGPFAGFSPKFLKTGSLFDLMHSVKSDNLFTMLSAGMKELPLTKY
LIQQVVLSNEKRMEELREFIPNAQSKDWDIVIAGQRVQVIKDTEDGGKGTLQFGTEVVCG
EDGTMAALLGASPGASTAVHVMLEVIQKCFPEHLQEWEPKIKEMIPSYGIALSENPELYK
EIEVSIEKALGLKNEEPMVIPS
NT seq 1509 nt NT seq  +upstreamnt  +downstreamnt
atgagtaacaaacacacgcaagcagacgttatcttaattggtgctggcataatgagtgct
acattaggatcacttctgaaagaactatcaccaaacttagaaattagagtatttgagaag
ctcgaaaatcctggagaagaaagctccaatgaatggaataatgctggtacagggcattca
gcattatgtgagcttaattatacttccgaaagaacagatggatctattgatatcaataaa
gcggttaaggtcaatgaacaatttcaactatcaagacagttttggtcttaccttgtaaat
cgtaacttgattcgtaatcccgaagactttatcagagcgttaccacatataagcttagta
caaggtgaggataatgttacattccttagaaagcgctttaaggcattagtgaatcatcca
ttatttaatggtatggagttctccgatgataacgaaaagttaaaagagtggatgccgctt
attatggataaacgagatacaaatgaacctattgcagcgacaaagattgattctggtaca
gatgttaatttcggtgctttaacgcgtcttttgtttcaagagtttgatcataaaggcatt
gatgtgaattacaatcatagtgtagaagatattaaacgaaatagtgaaggattatgggaa
gtaaaagttcatgatatgaacgatgaaaagattgaataccatactgctaaattcgtcttc
atcggtgctggtggtggaagtttgccattacttcaaaaaacaggtatcaaggaatcgaaa
catattggtggcttccctgttagtggtttatttatggtatgtaataatccggaagtaatc
gagcagcaccatgcgaaggtctatgggaaagctaaagttggtgcaccaccgatgtctgtt
ccgcatctcgatacgaggtttattgacgggaaaaaatcgttactatttggaccttttgcc
ggtttttcaccaaaatttttaaaaacaggttcattatttgatttaatgcattctgtgaaa
tcggataatctttttaccatgctttctgctggtatgaaggaattaccgttaacaaaatat
ctcattcaacaggttgtcctatcgaatgaaaaacgtatggaagaattacgtgaattcatt
cctaatgcacaaagtaaagattgggatattgttatagcaggacagcgtgtccaagtaatc
aaggatacggaagatggaggaaaaggtacactacaatttggtacggaagttgtttgtggt
gaggatggaaccatggcagcactattaggcgcttccccaggggcatctaccgcagtacat
gtgatgctagaagtgatacaaaaatgtttccctgagcatttgcaagagtgggaaccaaaa
attaaagaaatgataccttcttatggcatagcactttctgaaaatccagagttatataaa
gagattgaggtatctatcgaaaaggcacttggtttaaagaacgaagagcccatggtaata
ccttcttga

DBGET integrated database retrieval system