KEGG   Oceanobacillus iheyensis: OB2105Help
Entry
OB2105            CDS       T00093                                 

Definition
(GenBank) hypothetical conserved protein
  KO
K02428  XTP/dITP diphosphohydrolase [EC:3.6.1.66]
Organism
oih  Oceanobacillus iheyensis
Pathway
oih00230  Purine metabolism
Brite
KEGG Orthology (KO) [BR:oih00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    OB2105
Enzymes [BR:oih01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.66  XTP/dITP diphosphatase
     OB2105
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ham1p_like DUF3236
Motif
Other DBs
NCBI-ProteinID: BAC14061
JAMSTEC: OB2105
UniProt: Q8EPJ6
Position
complement(2139743..2140336)
Genome map
AA seq 197 aa AA seqDB search
MKKIIVATKNKGKAKEFKEFFASFDIEAISLLDLPESIPDIEETGTTFEENAALKAEQIS
ERFNTAVIADDSGLLIDALDGRPGLYSARYAGEPTNDQANIEKVLKEMQDVPDNDRSARF
ICVLAIAQPGKETNFCTGYCEGHIHSKQKGDHGFGYDPIFIPKKYDVTMAELDPAKKNQI
SHRKNAIDQLEKWLHTI
NT seq 594 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaataattgttgctactaaaaataaaggaaaggcaaaagaatttaaagaattt
tttgctagctttgatatagaagcaatatcactattggatttacctgaatctattcccgat
attgaggaaacaggtaccacttttgaagaaaatgcagccttaaaagcagagcaaattagt
gaacgctttaatacagctgttattgcagatgattcaggtttgttaatcgatgctctagat
ggacgacctgggctatattctgcacggtatgccggtgagccgactaatgatcaagcaaat
atcgagaaggtactaaaagaaatgcaggatgttcccgataatgatcgaagtgcaagattt
atttgtgtattagctatagctcaaccaggtaaagaaactaacttttgtacaggttattgt
gaaggacacattcatagtaaacaaaaaggcgatcatggatttggatacgatcctatcttt
attccaaaaaagtatgatgtgacaatggctgaattagatccagctaaaaagaatcaaatt
agtcatcgtaaaaatgcgattgatcagctagaaaaatggttacatacaatataa

DBGET integrated database retrieval system