KEGG   Oceanobacillus iheyensis: OB2404Help
Entry
OB2404            CDS       T00093                                 

Definition
(GenBank) isocitrate lyase
  KO
K01637  isocitrate lyase [EC:4.1.3.1]
Organism
oih  Oceanobacillus iheyensis
Pathway
oih00630  Glyoxylate and dicarboxylate metabolism
oih01100  Metabolic pathways
oih01110  Biosynthesis of secondary metabolites
oih01120  Microbial metabolism in diverse environments
oih01200  Carbon metabolism
Module
oih_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:oih00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    OB2404
Enzymes [BR:oih01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     OB2404
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ICL PEP_mutase DUF3338
Motif
Other DBs
NCBI-ProteinID: BAC14360
JAMSTEC: OB2404
UniProt: Q8ENS3
Position
complement(2457150..2458436)
Genome map
AA seq 428 aa AA seqDB search
MKNERVENLTKEWQDDIRWVGIERPYKAEDVIRLRGSIDITHTLATRGASKLWKLINEED
YVNALGALTGNQAVQQVKAGLKAIYLSGWQVAADANMAGEMYPDQSLYPANSVPQVVRRI
NQALQRSDQIHFSEGENDIDWFAPIVADAEAGFGGQLNVFELMKSMIEAGAAAVHFEDQL
SSEKKCGHLGGKVLLPTQNAVRNLIAARFAADVMGTPTIIIARTDANAADMITSDVDEYD
HLFITGERTVEGFYKTKAGIDQAIARGLAYAPYADLIWCETSEPNLEEARIFAEAIHEKF
PNKLLAYNCSPSFNWKKKLSDQEIAEFQKELGKLGYKFQFVTLAGFHALNHSMFDLAKKY
KSHGMAAYSELQQAEFSSEKDGYTATRHQREVGTGYFDEVAQVISGGKASTAALIGSTET
EQFTSFYK
NT seq 1287 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaatgaaagagtagagaatttaactaaagagtggcaagatgatattcgttgggtg
gggattgaacgtccgtataaagcagaagatgtaataagactcagaggttctattgatata
acgcatactttagcaactcgaggagcctcgaaattatggaaactgattaatgaagaagac
tatgtaaatgctttaggagcactgaccggaaatcaagcagttcaacaagtgaaagcggga
cttaaagcaatatatttaagcgggtggcaggttgctgctgatgcaaatatggcaggagaa
atgtatcctgatcaaagtctataccctgcaaatagtgtccctcaggtggtgagaagaatt
aatcaagcactacaacgatcggatcagattcatttttcagaaggggagaatgatattgat
tggttcgctccgatagttgctgatgcagaagctggttttggaggtcaactaaatgtattc
gaattaatgaaatcaatgattgaagcgggtgctgctgctgtccattttgaagatcaatta
tcatctgaaaagaagtgcggtcatctaggtggtaaagtgttgctgccaacacagaatgca
gtccgaaatttaatcgcagcccgatttgctgcagatgtaatgggtaccccaactataatc
atcgcacgcacagatgcaaacgcagcagatatgataactagtgatgtagatgaatacgat
catttatttatcactggagaaagaactgtagaagggttctacaaaacaaaggcaggaatc
gatcaggcaatagctagagggctagcatatgcaccttatgctgatttaatttggtgcgaa
acatcggagccaaatttggaggaagctagaatatttgcagaagctatacatgaaaagttt
ccaaataaattactcgcatataattgttcaccatcatttaattggaagaaaaaactctca
gatcaagaaatagcagagttccaaaaagagctaggtaaattaggttataaattccaattt
gtaacattagcgggttttcatgcattaaatcacagtatgttcgatttagctaaaaagtat
aaaagtcatggtatggcagcttattctgaattacagcaagcagaattttcaagtgaaaaa
gacggatatacagcaactaggcatcagagagaagttggtacaggttattttgacgaagtt
gcgcaagtcatttctggtggcaaggcttctactgcggcgttaataggttccactgaaaca
gaacaatttacaagtttttacaaataa

DBGET integrated database retrieval system