KEGG   Oceanobacillus iheyensis: OB3013Help
Entry
OB3013            CDS       T00093                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
oih  Oceanobacillus iheyensis
Pathway
oih00071  Fatty acid degradation
oih00072  Synthesis and degradation of ketone bodies
oih00280  Valine, leucine and isoleucine degradation
oih00310  Lysine degradation
oih00362  Benzoate degradation
oih00380  Tryptophan metabolism
oih00620  Pyruvate metabolism
oih00630  Glyoxylate and dicarboxylate metabolism
oih00640  Propanoate metabolism
oih00650  Butanoate metabolism
oih00900  Terpenoid backbone biosynthesis
oih01100  Metabolic pathways
oih01110  Biosynthesis of secondary metabolites
oih01120  Microbial metabolism in diverse environments
oih01130  Biosynthesis of antibiotics
oih01200  Carbon metabolism
oih01212  Fatty acid metabolism
oih02020  Two-component system
Brite
KEGG Orthology (KO) [BR:oih00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    OB3013
   00630 Glyoxylate and dicarboxylate metabolism
    OB3013
   00640 Propanoate metabolism
    OB3013
   00650 Butanoate metabolism
    OB3013
  09103 Lipid metabolism
   00071 Fatty acid degradation
    OB3013
   00072 Synthesis and degradation of ketone bodies
    OB3013
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    OB3013
   00310 Lysine degradation
    OB3013
   00380 Tryptophan metabolism
    OB3013
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    OB3013
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    OB3013
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    OB3013
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:oih04147]
    OB3013
Enzymes [BR:oih01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     OB3013
Exosome [BR:oih04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   OB3013
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt DUF5417
Motif
Other DBs
NCBI-ProteinID: BAC14969
JAMSTEC: OB3013
UniProt: Q8EM47
Position
complement(3122103..3123293)
Genome map
AA seq 396 aa AA seqDB search
MRKSVIVSGARTPFGKFGGALRPLKATELGGIAIKEAMERANIANDVVDEVIMGTVLQGG
QGQIPSRQAARIAGLPWETRSETINKVCASGMRSVTLADQLIRLGEEEIIVAGGMESMSN
APYFLPDARWGNRMGDKSVVDMMVHDGLTCTFTGNHMGNYGNSTAEDLEISRKRQDAWAF
RSHQKSVEAIESNKFADEIVPVEIPNRKGDPIIVDTDEAPRKDTTIDKLSSLRPAFDKEG
SITAGNAPGVNDGAAAFVVMSDEKAAELNKEPLAYILGHAEVAVEAKDFPQTPGIVINKL
LEKTGTSKEEIDLYEINEAFAVVALASGQIADIDEEKINVNGGAVALGHPIGASGARIIL
TLIHELKRRGGGKGIAAICSGSGQGDAILIEVPAEN
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atgagaaaatcagtaatcgtatctggtgcgcgaacaccttttgggaaatttggtggagct
ttaaggccgttaaaagcaacagagcttggaggtattgcaattaaagaagccatggaacga
gcaaatattgcaaatgatgtcgttgatgaggtaatcatgggaaccgtattacaaggcggt
caaggacaaatcccatcacgtcaagcggcaagaattgctggtcttccatgggagacgcga
tcggaaacaattaataaagtatgcgcatctggaatgcgaagtgttacgttagcagatcag
ttaatccgtctaggagaagaggagatcattgtagcaggtggaatggagagcatgagtaat
gccccgtactttttaccggatgcacgttggggaaaccgaatgggagataaatcggttgta
gatatgatggttcatgatggtcttacttgtacatttacaggaaatcatatggggaactat
ggtaattctacagcagaagatttagagatttctagaaagcgccaagatgcttgggcattt
cgcagtcatcaaaaatcggttgaagccatcgaatcgaataagtttgctgatgagattgta
cctgtagaaattcctaatcgaaaaggcgatccaataatagttgatacagatgaagcacca
cgtaaagatacgacgatagataaattatcatccttacgtccagcatttgataaagaggga
tcgataactgcggggaatgctcctggagtaaatgatggagcggcagcatttgtcgtcatg
tcggatgaaaaagctgcggaattaaataaagaaccccttgcttatattctcggtcatgca
gaagttgctgtagaagcaaaggacttcccgcaaacacccggaattgtaattaataaattg
ttagaaaaaacgggcacttctaaagaagaaattgacctatacgaaatcaatgaagcattt
gcagttgttgcgcttgcgagtggacagattgcagatatcgatgaagaaaaaataaatgta
aatggtggagccgttgcacttggtcatccaataggggcaagtggagcacgtatcattctt
acgcttatccatgaattaaaacgtcgtggcggcggaaagggaatcgctgctatttgtagt
ggaagtgggcaaggagatgccattcttattgaagtaccagctgaaaattaa

DBGET integrated database retrieval system