KEGG   Oceanobacillus iheyensis: OB3206Help
Entry
OB3206            CDS       T00093                                 

Definition
(GenBank) beta-N-acetylhexosaminidase (beta-hexosaminidase)
  KO
K01207  beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
oih  Oceanobacillus iheyensis
Pathway
oih00520  Amino sugar and nucleotide sugar metabolism
oih01100  Metabolic pathways
oih01501  beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:oih00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    OB3206
 Human Diseases
  Drug resistance
   01501 beta-Lactam resistance
    OB3206
Enzymes [BR:oih01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     OB3206
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_3
Motif
Other DBs
NCBI-ProteinID: BAC15162
JAMSTEC: OB3206
UniProt: Q8CX63
Position
complement(3336625..3338214)
Genome map
AA seq 529 aa AA seqDB search
MIEKIIGELFVIGFDGKVVPKSIKKLIHDYHIGGIILFTRNIGSPDEVLRLTASLQKEAR
DAGYERPLLICVDQENGTVRRLGEGTTIFPGGMTIGASDSEENAYQVGYASGTELRALGI
NWNLAPVVDVNVNPDNPVIGVRSYGESPERVARLAKAAVKGMQDAGVVTTLKHFPGHGDT
KVDSHLALPVIPHSIERLEEIELRPFQASLESDVIMSAHIYFPALEPEADKPATLSKAVL
TGLLREKLGYTGLITTDCMEMNAISETIGTEKGVVAALQAGVDLAMVSHTLQRQVGALQE
VKAAVESGELSRESILTSAERIRRVKDTYINWNNTSIDSGAKVPSFVGGNDHRKLAKEAY
RRGVTMVYNHGLIPIDSSSNIVVVTPEASAQSAAEDPSHATVRLYDAVRSYQPNAKNIAL
TSDWTEEDIHEQVEQWKQYDAVIFGVQYLAQQPMQQLLLETLAASDIPVIAIVMRSPYDV
ALLPELHTCICTYEVSSPALEVAVSAVFGEEEILGMLPVTIKSNQIKRI
NT seq 1590 nt NT seq  +upstreamnt  +downstreamnt
atgattgagaaaataataggagaactgtttgtaatcggttttgatggcaaagttgtccca
aaatcgatcaaaaagcttatccacgactatcatatcggtggaataattctttttacacgt
aatattgggagccctgatgaagtacttcgattaactgcttctttgcagaaagaagcacgt
gatgcgggatatgaacgtccactgctgatttgtgtcgatcaagaaaatggtacagtacga
cgtcttggagaaggaacgacaatatttcctggcgggatgacgattggtgcaagtgacagt
gaagagaacgcatatcaggtaggttatgcgagtggaacagagttaagagcattggggatt
aattggaacttagctcctgtagtagatgtgaatgtaaatccggataatccagttataggt
gttcgttcttacggagagtcaccagaacgtgtcgctcgtttagcaaaagcagcggtaaaa
ggtatgcaagatgcaggtgttgtgacgacgctcaaacattttcctggtcatggtgataca
aaagtggattcacatttagctttgccggttatccctcatagcatagagcgattggaagaa
atcgagttacgaccttttcaagcgtctttggaatctgatgtgattatgtctgctcatatc
tactttccagcattggaaccggaagcagataaaccagctacattatccaaagcagtatta
acaggattgcttcgagagaaattaggatataccggtttaattacgacggattgtatggaa
atgaatgcaatatcagaaacaattggtacagagaaaggggtcgtagctgcgttgcaagca
ggcgtggatctagctatggtatcacatacgttacaacggcaagttggtgcgcttcaagaa
gtgaaggcagcggtagagtcaggcgaactgagtagagaatctatattaacctcggcagaa
cgaatcaggcgcgttaaagatacatatatcaattggaataatacgagtatagattccggt
gcaaaggtaccttcttttgtcggtggcaatgatcatcgtaaattggcgaaggaagcctac
cgacgaggtgtgacaatggtttataatcatgggctcataccaatagatagtagtagcaat
atagttgttgtcacaccagaagctagtgcgcagtcggcagcagaggatccatctcatgca
actgttcgtctttatgatgcagtgcgttcatatcagccgaatgccaaaaacatagcatta
acatcggattggacagaagaagatatacatgagcaagtagaacagtggaagcagtacgat
gcggtgattttcggggtgcagtatttagcgcagcaaccgatgcaacagttattattagaa
acacttgccgcaagtgacataccagtaatcgcaatcgttatgagaagcccttatgatgta
gcattattaccagaacttcatacttgtatatgtacgtatgaagtctcctctccagctcta
gaagtagctgtgagtgctgtgttcggggaagaagaaatcttaggtatgttgccagtaaca
ataaaatcaaaccagataaaaagaatatag

DBGET integrated database retrieval system