KEGG   Oceanobacillus iheyensis: OB3353Help
Entry
OB3353            CDS       T00093                                 

Definition
(GenBank) alcohol dehydrogenase
  KO
K00004  (R,R)-butanediol dehydrogenase / meso-butanediol dehydrogenase / diacetyl reductase [EC:1.1.1.4 1.1.1.- 1.1.1.303]
Organism
oih  Oceanobacillus iheyensis
Pathway
oih00650  Butanoate metabolism
Brite
KEGG Orthology (KO) [BR:oih00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    OB3353
Enzymes [BR:oih01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.4  (R,R)-butanediol dehydrogenase
     OB3353
    1.1.1.303  diacetyl reductase [(R)-acetoin forming]
     OB3353
    1.1.1.-  
     OB3353
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N ADH_zinc_N_2 Glu_dehyd_C ADH_N_assoc AlaDh_PNT_C 2-Hacid_dh_C Methyltransf_25
Motif
Other DBs
NCBI-ProteinID: BAC15309
JAMSTEC: OB3353
UniProt: Q8EL78
Position
complement(3488621..3489676)
Genome map
AA seq 351 aa AA seqDB search
MKAAVWYGKHDIRVENKEEPIIKPGKVKIKVAWTGICGSDLHAYHGAEGVVQVGEPHPVT
GEMAPLTLGHEFSGVIHEIGEGVSGLSVGDRVAIEPAIKCGKCENCVRGNYNLCEHNGFV
GLQSDGAFAEYAIVDPHMVHKLPDNISFEEATAIEPTAVSFHALKLSNMKAGDTVAVFGV
GPIGLTAILCAKAAGASRIYAIDVSNERLEMAQKLGATTVINAIEENAAEKIYAETGSGV
TIAFDCAGAEATVNSAIDSLAKGGQLVIVSIIPEPIKVNLLQANLKEINILATIGYRDVY
KDVIAMVESGQLDLKPIITKKIGLDDIIEEGFHALTNDKSQAKILVSPTGV
NT seq 1056 nt NT seq  +upstreamnt  +downstreamnt
atgaaggcagcagtttggtatggtaaacacgatattcgtgtagagaataaggaagaacct
ataattaaacctggaaaggttaaaataaaagtagcatggacaggcatttgtggaagtgac
ctgcatgcttatcacggcgctgagggagtcgttcaagttggcgaacctcatcctgtaact
ggtgaaatggcaccattgacgcttgggcatgagttttctggtgtaattcatgaaattggt
gaaggtgtaagcggtttatctgttggagatcgtgtagcgattgagccggctattaagtgt
ggcaagtgtgagaattgtgtacgaggaaactacaacttgtgtgaacacaatggctttgtt
ggcttacaatctgacggtgcttttgctgagtatgcaattgttgatccacatatggttcac
aagcttccagataatatatcgtttgaagaagctacagcaattgagcctacagctgtgtct
ttccacgcgcttaaattaagcaatatgaaagcaggcgatacggtagcggtctttggtgtt
ggcccaattggtcttacggcgattctatgtgcgaaggcagctggtgcgtctcgtatttat
gcgattgatgtttccaatgagcgtcttgagatggctcaaaagcttggcgcaactacggtt
attaatgcgatagaagagaatgcggcagaaaagatatatgctgaaacaggaagtggcgtt
actatcgcatttgattgtgcaggagctgaagcgactgtgaacagtgcaattgattcactt
gctaaaggcggacaacttgtcattgtgtccattattccagaaccgatcaaagtaaatctt
ttgcaggcgaacttaaaagaaataaacattcttgcaactatcggttacagagatgtgtat
aaagacgttattgctatggtggaatcaggacagctggatcttaaaccgatcatcactaaa
aaaatcggtttggatgatattatcgaagaaggcttccacgcccttacaaatgataagagc
caagcaaaaattcttgtgagcccaacaggggtttaa

DBGET integrated database retrieval system