KEGG   Oryzias latipes (Japanese medaka): 100049529Help
Entry
100049529         CDS       T02443                                 

Definition
(RefSeq) 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase beta-3 isoform X1
  KO
K05858  phosphatidylinositol phospholipase C, beta [EC:3.1.4.11]
Organism
ola  Oryzias latipes (Japanese medaka)
Pathway
ola00562  Inositol phosphate metabolism
ola01100  Metabolic pathways
ola04020  Calcium signaling pathway
ola04070  Phosphatidylinositol signaling system
ola04261  Adrenergic signaling in cardiomyocytes
ola04270  Vascular smooth muscle contraction
ola04310  Wnt signaling pathway
ola04371  Apelin signaling pathway
ola04540  Gap junction
ola04621  NOD-like receptor signaling pathway
ola04912  GnRH signaling pathway
ola04916  Melanogenesis
ola04933  AGE-RAGE signaling pathway in diabetic complications
Module
ola_M00130  Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Brite
KEGG Orthology (KO) [BR:ola00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    100049529
 Environmental Information Processing
  Signal transduction
   04310 Wnt signaling pathway
    100049529
   04371 Apelin signaling pathway
    100049529
   04020 Calcium signaling pathway
    100049529
   04070 Phosphatidylinositol signaling system
    100049529
 Cellular Processes
  Cellular community - eukaryotes
   04540 Gap junction
    100049529
 Organismal Systems
  Immune system
   04621 NOD-like receptor signaling pathway
    100049529
  Endocrine system
   04912 GnRH signaling pathway
    100049529
   04916 Melanogenesis
    100049529
  Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100049529
   04270 Vascular smooth muscle contraction
    100049529
 Human Diseases
  Endocrine and metabolic diseases
   04933 AGE-RAGE signaling pathway in diabetic complications
    100049529
Enzymes [BR:ola01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     100049529
Membrane trafficking [BR:ola04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Phospholipases
    100049529
 Endocytosis
  Macropinocytosis
   Phospholipase C
    100049529
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PI-PLC-X PI-PLC-Y PLC-beta_C DUF1154 C2 EF-hand_like
Motif
Other DBs
NCBI-GeneID: 100049529
NCBI-ProteinID: XP_023821578
Position
18
AA seq 1237 aa AA seqDB search
MAGAKPGVHALQLKPVSVHEDLKRGGKFIKWDEDPNGGSPTLVTLKVDPDGFFLSWTAGS
NLEVEILDISTIRDTRTGKYARQPKEAKLQSMLSVGKDSFLGKSLTIVYGNDLVNISYLN
FQAMSEDEAKLWTEELFSLATNILSHNATRNSYLLKAYTKLKLQVNQEGKIPVKNIMKLF
SDKRRVETALEQCGLVRNKSEGIKPDDFTWEAFQKFLNNLCLRPEIQTIFEESSKKKPFI
SLDQFMDFLNRRQRDSRLNEVLYPPLKREQVRQIMEKYETNSSQLDRDQISLRAFSLYLG
GEENGIVPPERLDIIDDMNQPLSHYFINSSHNTYLTVGQLTGLSSVEMYRQVLLTGCRCI
ELDCWQRQDEEPHITHGFTMTTEIPFKDVIEAIAESAFKTSPYPVILSFENHVESPKHQA
KMAEYCRTIFGDALLIDPLEKYPLVPGQPLPSPQDMMGKILIKNKKKHHHHRPSETSVRR
KELEEPSSIPNDCPLSDGDGNQTLSNGEEKLAESLMKEVEPRKSIAEGESEEEEEDESAT
ETKKNSDEGTASSEVNATEEMSNLVNYVEPVKFKSFDLAAKKRKYFEMSSFVETKGMEAL
KNSPVEFVEYNKNQLSRIYPKGTRVDSSNYMPQVFWNVGCQMVALNFQTLDLAMQLNMGV
FEYNGRSGYLLKPEFMRRMDKHFDPFTESIVDGIVANTVKIKVVSGQFLTEKKVGVYVEV
DIFGLPADTKRKYRTKTSSNSNSLDPVWDDEMFVFNKVILPSLASLRIAVCEENGKFIGH
RILPISSIRPGYHYINLKNELSQPLLLPSLLIYIEVQDYVPNEHQEYADALTDPIKYISQ
LAKREKQLASLIDDNVEQQDSSQPKDSIRRTSITTAGFQPLPSFQPPTLSPIEDCPDVII
KPPPPVQTPVQKEDPIATILAEMQVLSVEDLKQQKNYVKLVKKQEKDIKELRKKHLKKVC
SLYKKQKSQSSQVESDTHKKRSQMEKSLKRSIKKNEPQEGMKKELTKLEQEVEEQTVKMW
EGQMEKLVKLRQELHVLERQMQEKHLHEAFQRLKDICQECQAAQIKKLKESCEKEKKELQ
KMLERKRLNSISEAKNKEEQEKINTKHISESVSLFRKLETEQEKRQDKLIQKYTEMLQHI
QEELPTLQAQLAQDLQEEFHRLPEEIYQHLNLERHNKSLRRFSNNSSPGSNCGTRSLPST
PDQSLLNSSMDRSTSSLADSCSPSTTPVHSEAEISFT
NT seq 3714 nt NT seq  +upstreamnt  +downstreamnt
atggccggggccaagccgggagtccacgcgctgcagctgaagcccgtgagcgtgcacgag
gacctgaagagagggggaaagttcatcaaatgggacgaggatcccaacggcggcagccca
acactggtgaccttgaaagttgacccagatggatttttcctctcatggactgccggctca
aacttggaggtggagatcctggacatcagcaccatcagggacaccaggacgggaaagtac
gcccgacagccaaaggaagcgaaattgcagagcatgctgagcgtcgggaaggacagcttt
ctggggaagtcgctgaccatcgtctacggaaacgacttggtgaacatctcctacctcaac
ttccaggcgatgtcggaggatgaagccaagctttggacagaagagctcttcagtttggca
acaaacatcctttcccacaatgcaacaagaaacagctacctcctcaaagcatacaccaag
ctgaagctgcaagtgaaccaggagggcaaaattcccgtgaagaacattatgaagttgttc
tctgataaacggcgggtggagacggcgctggagcagtgcggcctggtcagaaacaagtcg
gagggaataaagcctgacgattttacgtgggaggccttccagaagtttctcaacaacctg
tgtctgcgacctgaaatacaaaccatctttgaggaaagctccaagaagaagcccttcatc
tctttggaccagttcatggacttcctgaaccgcaggcagcgggactccaggctgaacgag
gtcctgtatcctccgctgaaacgagagcaggtccggcagatcatggagaaatacgagacc
aacagcagccagctggacagagaccagatcagcttgagggctttcagtctctacctggga
ggagaggaaaacggcatagttcctccagagaggctggacatcatcgacgacatgaaccag
ccgctgtcgcactactttatcaactcctcacacaacacatacctcacagtgggtcagctg
acgggtctgtcgtcggtggagatgtacaggcaggtgctgctgacgggctgccgctgcatc
gagctggactgctggcagaggcaggacgaggagccgcacatcacgcacgggttcaccatg
accacagagatccccttcaaggatgtgattgaagccatcgcagaaagtgccttcaagacg
tcgccttatcctgtcatcctctcctttgagaatcacgtcgagtcacccaaacatcaagcc
aaaatggccgagtactgccggaccatctttggagacgctctgctcatcgaccctttagag
aaatacccgctggtcccaggtcagccgctaccatcaccacaggacatgatggggaagatt
ctcatcaaaaacaagaagaagcatcaccatcatcgaccatcagagaccagcgtacggcgt
aaggagctggaggagccttcgagcatccccaatgactgccctctgtcagacggggatggg
aaccagacgctttccaacggggaggagaagctggctgaaagcctgatgaaagaagtggag
cctcgcaagtcgatcgctgaaggagagagcgaggaagaagaagaagacgagtcagctaca
gagacgaagaagaactcggatgagggaaccgccagcagtgaggtcaacgccacggaggag
atgtcaaacctcgtcaattatgttgaacctgttaaatttaaaagctttgacttggcagcg
aagaaaaggaagtactttgagatgtcgtcttttgtggaaaccaaaggcatggaagccctt
aagaactcgcctgtagagtttgtcgagtacaacaaaaaccagctgagccgaatctaccct
aaaggaacgagggtggacagctccaactacatgccacaggtcttttggaacgtcggttgt
cagatggtggcgctaaacttccaaacccttgacctcgcgatgcagctgaacatgggagtg
tttgaatataacgggcgcagtggctatctgctaaaaccagagttcatgaggaggatggac
aaacactttgacccgttcacagaaagcattgtggacggaatagttgccaacacagtcaaa
attaaggtggtgtcagggcagttcctcacagaaaaaaaagtgggagtgtatgtcgaggtg
gacatatttggactcccagctgacactaagaggaaatacagaacaaaaacctcctccaac
agcaattcacttgatcctgtgtgggatgacgagatgtttgttttcaataaggtgatcctt
ccttcactggcttctctcaggatagctgtgtgtgaggaaaacggaaagtttattgggcac
cgaattctccctatttcctccattagacctggttatcactacatcaacctgaagaatgag
ctgagccagccactgctgctgccctccctcctcatttacattgaagttcaggattacgtc
cctaatgaacaccaggagtacgcagatgctctgaccgacccaatcaagtacatcagtcaa
ctggctaaaagagagaaacagcttgctagtctcattgacgacaacgtggagcagcaagat
tcctctcagcccaaagactctatccgtagaacctctataaccacggctggatttcagccc
ctaccatctttccagccgcctactctatcccctatagaggactgtccagacgtcatcatc
aaaccaccaccaccagtacaaactccagtacaaaaggaggacccgatagccacaatcctg
gcagaaatgcaggttctctctgtagaggatctgaagcagcagaagaattatgtgaagctg
gtgaaaaagcaagaaaaagacatcaaagagctgcgcaagaaacacctgaagaaggtttgc
agtctgtataagaaacagaagagtcagagcagccaggtggagtctgacactcacaagaag
cgcagtcaaatggaaaaaagcctcaaacgcagcatcaagaaaaatgagcctcaggagggg
atgaagaaggagctgaccaagctggagcaggaggtggaggagcagacggtcaagatgtgg
gaggggcaaatggagaaactggtcaagcttcgacaggagcttcacgtgctggagagacag
atgcaggaaaaacacctgcatgaggcgttccaaaggttaaaggatatatgtcaagagtgc
caagcagctcagataaagaagctgaaggagtcgtgtgaaaaagagaaaaaggagctccag
aagatgctagaaaggaaacgacttaacagcatcagtgaagccaagaacaaagaggaacag
gagaagatcaacacgaaacacatcagtgaatccgtctctttgttccgtaagctggagacc
gagcaggaaaagagacaagataagctgatacagaagtacaccgagatgctgcagcacatt
caggaggagctgcccacgctccaggctcagctggctcaagacctccaggaggagttccac
cgcctcccagaagaaatctaccagcaccttaacctggagcgccacaacaaaagcctcagg
aggttctcgaacaacagcagcccgggatccaactgcggcacgcgctccttaccctccacg
ccggaccagagcctgttgaacagcagcatggacagaagcacctcctcgctggccgattcc
tgctccccgtccaccactcctgtccactccgaggcagagatctccttcacttag

DBGET integrated database retrieval system