KEGG   Oryzias latipes (Japanese medaka): 100125503
Entry
100125503         CDS       T02443                                 

Gene name
rdh5
Definition
(RefSeq) 11-cis retinol dehydrogenase
  KO
K00061  11-cis-retinol dehydrogenase [EC:1.1.1.315]
Organism
ola  Oryzias latipes (Japanese medaka)
Pathway
ola00830  Retinol metabolism
Brite
KEGG Orthology (KO) [BR:ola00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    100125503 (rdh5)
Enzymes [BR:ola01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.315  11-cis-retinol dehydrogenase
     100125503 (rdh5)
SSDB
Motif
Pfam: adh_short adh_short_C2 DUF1776 KR PLAC9
Other DBs
NCBI-GeneID: 100125503
NCBI-ProteinID: XP_004068760
Position
5
AA seq 346 aa
MFFQRGQDQKNNPESYMDFIFNVLRENAWLYITATVMVMWFFGWLFRDSLQIENFHEKYV
FVTGCDSGFGHLLCKKLDRKGFRVLAGCLTEKGADDLKRATGPYLKTVLLDVTSQESIQK
TMEWTKKEVGDKGLWGLVNNAGRSLPMGPSEWMTVDDYHSTLKVNMIGVIAMTTTFLPLI
KKARGRIVNVASVLGRVAANGGGYCISKFAVEAFSDCLRRDINHFGISVCIIEPGFFKTA
VTSLDPLERELHRLWNQLSPEVKASYGDQYLEKYIKVQRLIMNAVCDSDLTKVTSCMEHA
LTAAYPRTRYSAGWDAKFLWLPLSYMPACVVDIGLKLVLPRPSKSV
NT seq 1041 nt   +upstreamnt  +downstreamnt
atgtttttccagcgaggtcaagaccaaaaaaacaatcctgaaagctacatggattttata
tttaatgttttaagggaaaatgcctggctgtacatcactgctactgtcatggtgatgtgg
ttttttgggtggctgttcagagacagcttacaaattgaaaacttccatgaaaagtatgtt
tttgtcactggctgtgactcaggatttggacatctcctgtgtaagaaactggaccgtaag
ggtttccgtgtgctggccggctgtctcacagagaagggagcagatgatctgaaaagagcc
acagggccttatctgaagacagttctgctcgatgtgacaagtcaggaaagcatccaaaaa
acaatggagtggaccaaaaaggaggttggcgataaaggactttggggtcttgtaaataat
gctggccgttcattacccatggggccttcagagtggatgacggtggacgattatcacagc
acgctgaaagtcaacatgattggagtgattgccatgacgactacctttctgcccctcatc
aaaaaggccaggggtcgtatcgtaaacgtagcatcagtgctgggacgggtggctgcaaat
ggcggtggttactgcatctccaagtttgcagtggaagctttttctgactgtctccggcgg
gatatcaaccattttggaattagtgtttgcatcattgagcctggattcttcaagacggct
gtgaccagcctggatcccctcgagagggagctgcatcggttgtggaaccagctcagccct
gaagtcaaagccagttatggagatcagtacctagaaaaatacatcaaagttcaacggttg
atcatgaacgctgtctgcgactccgacctgaccaaggtgacgagctgcatggagcacgct
ctgactgcggcctacccacgcacccggtacagcgccggctgggatgccaagtttctctgg
ctccccctctcctatatgcctgcctgtgtggttgacattggtctgaaactggtgttacct
cgtccttccaagagcgtataa

DBGET integrated database retrieval system