KEGG   Oryzias latipes (Japanese medaka): 100125517Help
Entry
100125517         CDS       T02443                                 

Definition
(RefSeq) UDP-glucuronosyltransferase
  KO
K00699  glucuronosyltransferase [EC:2.4.1.17]
Organism
ola  Oryzias latipes (Japanese medaka)
Pathway
ola00040  Pentose and glucuronate interconversions
ola00053  Ascorbate and aldarate metabolism
ola00140  Steroid hormone biosynthesis
ola00830  Retinol metabolism
ola00860  Porphyrin and chlorophyll metabolism
ola00980  Metabolism of xenobiotics by cytochrome P450
ola00982  Drug metabolism - cytochrome P450
ola00983  Drug metabolism - other enzymes
ola01100  Metabolic pathways
Module
ola_M00014  Glucuronate pathway (uronate pathway)
Brite
KEGG Orthology (KO) [BR:ola00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    100125517
   00053 Ascorbate and aldarate metabolism
    100125517
  Lipid metabolism
   00140 Steroid hormone biosynthesis
    100125517
  Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    100125517
   00860 Porphyrin and chlorophyll metabolism
    100125517
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    100125517
   00982 Drug metabolism - cytochrome P450
    100125517
   00983 Drug metabolism - other enzymes
    100125517
Enzymes [BR:ola01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.17  glucuronosyltransferase
     100125517
Glycosyltransferases [BR:ola01003]
 Others
  Hydrophobic molecule
   100125517
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: UDPGT Glyco_tran_28_C Glyco_transf_4 Glyco_trans_4_2
Motif
Other DBs
NCBI-GeneID: 100125517
NCBI-ProteinID: XP_004086969
Position
21
AA seq 527 aa AA seqDB search
MGVRGWFPTAGLLAWLCCLSLGPVQGGKVLVMPVDGSHWLSMKILVKELSRRGHEVTVLV
PESSLLIKGSKDYKTEVHKVPFTQEELNGKFDKLRESVFVKTPEFTDMFVNVQRLVEFTT
LQVKGCESLLDSEDLMERLRGEGFDAMLTDPFLPCGSILAKMFSIPAVYFLRGLPCELDY
KANQCPSPPSFVPVFYSGSTDKMNFLQRVKNFFMYNVQSYVCTVLYQHFDDLVSRRIESG
MSYKDLLSHGAIWLFRYDFTFEWPRPLMPNMVLIGGINCAKKAPLPTDLQEFVDGSGDDG
FIVFTLGSMVSTMPAEKAKQFFDAFRQIPQRVLWRYTGELPEDMPKNVKVMSWLPQNDLL
AHPKIKVFITHGGTHGIYEGICNGVPMLMFPLFGDQGDNVHRLVARGVAEKLSMLDVTTE
TLLAALKKLIYDKSYKERMATLSSIHLDRPIEPLELATFWTEFVMRHKGATHLRVAAHDL
NWFQYHSLDVIGVLAIVVITVLWVTLKCCSFGVRKCCGRRSSKKKSE
NT seq 1584 nt NT seq  +upstreamnt  +downstreamnt
atgggtgtcagagggtggtttcccacagcagggctgctggcttggctgtgctgcctcagt
ctggggcccgttcagggggggaaggtgctggtcatgcctgtggatggaagtcactggctc
agcatgaagattctggtgaaggagctcagtcgcagaggccatgaggtcacagttctggtg
cctgaaagcagcctgctgatcaaaggctcgaaggactacaagacggaggtccacaaagtt
cccttcacccaggaggaactgaatggaaagtttgacaaactcagggagtcggtgttcgtc
aagaccccagagtttacagatatgtttgtcaatgtgcagcgtttggtggagtttaccacc
ctgcaggtgaaaggttgtgagagtctgctggacagcgaggatctgatggagaggctgaga
ggagaaggattcgatgccatgctgaccgaccccttccttccctgcggctccatcctggct
aagatgttttccattccagctgtttattttctgcgcgggcttccatgtgagctggattac
aaggccaaccagtgtccctctccgccttcttttgttcccgtgttttactccgggagcaca
gacaaaatgaacttcctgcagagagtgaagaacttcttcatgtacaacgtgcagtcctac
gtctgcacggtgctttaccagcactttgacgatctggttagcaggcgcatcgaaagtggc
atgtcctacaaagatctcctgagccacggggcgatctggctcttcagatatgatttcact
tttgaatggcccagacccctcatgccaaacatggtgttgattggtggaatcaactgtgcc
aagaaagcccctctcccaaccgacctgcaggagtttgtggacggctcaggagacgacggc
ttcatcgtcttcacgctgggctcaatggtgtccacaatgcctgcggagaaggccaaacag
ttcttcgatgcattccgccagatcccccagagggttttgtggagatacacaggagagctg
cccgaagatatgcccaaaaatgttaaagttatgagttggctacctcagaatgacctttta
gcccatcccaaaatcaaagtcttcataactcatggaggcacccatggaatctatgagggc
atctgcaacggggtgcccatgttgatgtttcctcttttcggggaccagggggataacgtg
catcggttggtggctcgcggggttgcagagaagctcagcatgttggacgtgacgactgaa
actctactggctgcactgaagaaactcatttatgacaaaagctacaaagagcggatggcg
actctgtcctccatccacttagaccggcccattgagccgctggaactggcgactttctgg
accgagtttgtcatgagacacaaaggagccacacatctacgggtggctgcacatgacctg
aactggtttcagtaccacagcctggacgtcatcggcgtcctcgccatcgtcgtcatcacc
gtgctgtgggtgactctgaaatgctgctcgttcggcgttcgcaagtgttgtggacgccga
agctcaaagaagaagtctgagtga

DBGET integrated database retrieval system