KEGG   Oryzias latipes (Japanese medaka): 100301621
Entry
100301621         CDS       T02443                                 

Gene name
foxo3
Definition
(RefSeq) forkhead box protein O3
  KO
K09408  forkhead box protein O3
Organism
ola  Oryzias latipes (Japanese medaka)
Pathway
ola04068  FoxO signaling pathway
ola04137  Mitophagy - animal
ola04218  Cellular senescence
Brite
KEGG Orthology (KO) [BR:ola00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    100301621 (foxo3)
 09140 Cellular Processes
  09141 Transport and catabolism
   04137 Mitophagy - animal
    100301621 (foxo3)
  09143 Cell growth and death
   04218 Cellular senescence
    100301621 (foxo3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:ola03000]
    100301621 (foxo3)
Transcription factors [BR:ola03000]
 Eukaryotic type
  Helix-turn-helix
   Fork head/winged helix other regulators
    100301621 (foxo3)
SSDB
Motif
Pfam: FOXO_KIX_bdg Forkhead FOXO-TAD
Other DBs
NCBI-GeneID: 100301621
NCBI-ProteinID: NP_001153937
UniProt: C1K304
Position
24
AA seq 668 aa
MAEAPLPDALPDLDVAIDPDFEPQKRPRSCTWPLPRPDSAAVKPESNDTDIIPEEEDDEE
DATPTAARVNGSVAAAEDQSSNSPVGDGALPSPGQESGGSPLSSHSPAATSGALTPSGLA
AAQTPRKTSSRRNAWGNLSYADLITQAIESSPEKRLTLSQIYDWMVRSIPYFKDKGDSNS
SAGWKNSIRHNLSLHSRFIRVQNEGTGKSSWWMINPEGGKGGKAPRRRAVSMDNSNKYTK
SARGRAAKKKAALQAAAAAAGEGGGDSPSGLSRWPGSPTSHSTEELDGGWTDFRSRTNSN
ASTVSGHLSPIMANPELDEVPDDEAPLSPMIYSSPGRALSPGNAISNGKAAPAELPRLAD
LTGTMNLNDGITDELMDDLLDNIKLVPPSSSQNLQNGSSGFTFGSKSNGISLTSSTSSPS
SNSSSNGGSNGYSNSIFGSQAIGSSLRSSPMQTIQENKQTSFSSISMSGFGSQTLQDLLN
SGSHNHSDVMMTQSDPLMSQASSAAVNSQNSRRGLILRNDPVMTFGTSGGIQASQRDVLQ
TNNQNQSSMRSRNGGLNLVNEANTLANAKQQLLLSPLGGNGSSTMQIDPSIFLNGTVSSS
GGVSQDRFPTDLDLDIFNGSLECDMDSIIRNDLMDADGLDFNFDSLVNMNGVSNFTSTKQ
SSQSWVPG
NT seq 2007 nt   +upstreamnt  +downstreamnt
atggccgaggccccgcttcccgacgcgctaccggacttggacgtggccatcgacccggac
tttgagcctcaaaagcggcccagatcctgcacttggccgcttccacggccggactccgct
gcggtgaagccggagagcaacgacacagatattataccggaggaggaagacgatgaggag
gatgctacccccacagctgcacgcgtcaacggctccgttgcagccgcggaggaccagagc
agcaacagccccgtgggtgatggagcgctgccttcccccggtcaagagagcggaggctcg
ccgctctcctcgcactccccggcggccacctccggcgccttgactcccagcggcttggct
gcagcgcagaccccgaggaagacctcctcccgccgcaacgcctgggggaacctctcctac
gccgacctgatcacccaggccattgagagttcgcccgagaagaggctgactctgtcccag
atttatgactggatggtgagatccatcccctacttcaaagacaaaggcgacagcaacagc
tctgcgggatggaagaactccatccggcacaacctctccctccacagtcggttcattcgc
gtccaaaacgaagggacaggaaagagttcctggtggatgatcaatccggaaggaggaaaa
ggcggcaaggctccaagacgtcgggctgtttccatggacaacagcaacaagtacaccaag
tccgcccgtggtcgtgctgctaagaaaaaggctgcactgcaggctgctgctgccgcagca
ggtgaaggtggtggagacagtccttcaggtctttccaggtggcctgggagtccaacatcc
cacagcacagaggagcttgatggtggatggacagatttccgctctcgcaccaactccaat
gccagcactgttagtggccacctctcacccattatggccaaccctgaacttgacgaagta
cccgatgatgaggctcctctctcccccatgatctactccagtcctggcagggcgctgtct
cctggaaatgccatatccaacgggaaagcagcccctgctgagctgccccgcctagcggac
ctgacaggtacgatgaacttgaatgatggaatcacagatgaactgatggacgatttgctt
gacaacatcaagttggtaccaccttcctccagccagaacctccaaaatggctcttcaggc
ttcacttttgggtccaaatccaatggaataagcttaacttcctccacatcctctccatcg
tccaactcttcatctaatggtggaagtaatggttacagtaactccatctttggctcccaa
gcaataggttcctctctgcgctcctccccaatgcaaaccatccaggagaacaagcaaaca
tctttctccagcatcagcatgtctggttttggcagccaaacactacaagacctgcttaac
tctggtagtcacaaccatagtgatgtgatgatgacccagtctgaccctttgatgtcgcaa
gccagctcagctgctgtcaattcccaaaactcccgccgtggtctgatcctccgtaacgat
cctgtgatgacctttgggaccagtggaggtattcaagccagccagagggacgtgctacaa
actaacaaccaaaaccagagctccatgaggtcaagaaatggaggtctgaacctcgtcaac
gaggctaatactctggctaatgctaaacagcagctcctgctctcaccattaggaggaaat
ggttcgtccaccatgcagatcgacccctccatctttcttaacggcaccgtcagcagcagc
ggaggagtttctcaggatcgcttccccaccgatctggacctggacatattcaacggcagc
ctggagtgtgacatggactccatcatcagaaacgacctgatggatgcagatggcctggat
tttaactttgactctctggtaaacatgaacggagtaagcaacttcacgagcaccaagcag
agctctcagagctgggtacctggctga

DBGET integrated database retrieval system