KEGG   Oryzias latipes (Japanese medaka): 100302443Help
Entry
100302443         CDS       T02443                                 

Gene name
nr3c2
Definition
(RefSeq) mineralocorticoid receptor
  KO
K08555  mineralocorticoid receptor
Organism
ola  Oryzias latipes (Japanese medaka)
Brite
Transcription factors [BR:ola03000]
 Eukaryotic Type
  Zinc finger
   Cys4 estrogen-like
    100302443 (nr3c2)
Nuclear receptors [BR:ola03310]
 3. Estrogen like
  3C. 3-Ketosteroid receptor
   100302443 (nr3c2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: zf-C4 Hormone_recep
Motif
Other DBs
NCBI-GeneID: 100302443
NCBI-ProteinID: NP_001156601
UniProt: C4B4D1
Position
1
AA seq 994 aa AA seqDB search
MEAKRYQSFFDGDDTENKWSQVPSDMEYCCNTDDSSLTNSETLMDMVNVSCSAGSPIADS
KDNNSNKQEQPRLQLGRDQPFLLPHFNNSLHGHKQEMDSKELSKTVAESMGLYMNAAREA
DFAFSQQGGNTSPGKLHPVSGQPPEEKRCGSTKSPKLKPFNFQHPIATPRECPSAAPVSS
ASILASSLSCSPKTSSSMSSPGGSNNMVSSTTSPSTCFGPQCSAVSSPVSQTSCAATLAN
IKRRNSVTCSPVESCTVGSPPLTSPLNIMRSPMSSPHSMSSVRSPPSCSTTCNIRSSVSS
PTGGSCTGVPNNCCSVRPSNSSPTTGGTLAVSSPHNPSSGGFSESSPAGGLGLVQNDSSS
PEVPGLTRDTNFKNFEFPKVEMVGGEVFSVGLDQMGMVKYIKNEPESDFRSMCLGSSKCN
TSSTPYITQIKSEPNKGEGCMNQQSYDEQSPSLDLFPTSDTTYLSLRNNIDEYNLSGILG
PPVSSMNGSYEPDMFSSNVLSKGVKQESTDGSYFQENNTMPTSAIVGVNSTGHSFHYQIG
AQGTMSFTRHDVRDQSNPLLNLISPVTALMESWKSRPGMPHGSFSARGEGYPSQNCIGDN
MSSSSLRQPSSTAKVCLVCGDEASGCHYGVVTCGSCKVFFKRAVEGQHNYLCAGRNDCII
DKIRRKNCPACRVRKCLQAGMNLGARKSKKLKLKGVSEDLQSSKDGQTATGGVGGSYLTS
EKELNSSAANALVPHGPGVVTPFLSPSICSVLELIEPEEVYSGYDNTLPDTTDHLLSSLN
RLAGKQMVRMVKWAKVLPGFRVLPIEDQITLIQYSWMCLSSFCLSWRSYKHTNGQMLYFA
PDLVFNEDRMRQSAMYDLCLGMRQVSQEFVRLQLTYDEFLSMKVLLLLSTVPKEGLKNQA
AFEEMRVNYIKELRRSVGKATNNSGQTWQRFFQLTKLLDAMHDLVGNLLDFCFYTFRESQ
ALKVEFPEMLVEIISDQIPKVESGLTHTIYFHKK
NT seq 2985 nt NT seq  +upstreamnt  +downstreamnt
atggaagcaaaaagataccaaagcttctttgatggagacgacacagagaacaaatggtct
caggtccccagtgatatggagtactgctgcaatacagatgattccagtctgacgaacagt
gaaaccttgatggacatggtcaatgtcagctgctctgctggaagccccattgccgacagc
aaagacaacaactctaacaaacaggagcagccaaggcttcagctcggcagggaccagcca
tttctcctcccacatttcaacaactccctgcatggtcataagcaggaaatggactccaag
gagctttccaagactgtggctgagtctatgggcctgtacatgaacgctgccagggaggct
gactttgcttttagccagcaaggaggcaacacaagtcctgggaagctgcatccagttagt
ggacagcctccagaggagaagcggtgtggctcaacaaagagccctaagttgaagccattc
aattttcagcaccctatcgccactccaagagaatgcccctctgcggctccagttagctct
gcgtccattttggcctcctctctgtcctgcagtcctaagacctctagctcaatgtccagt
cctggaggaagtaacaatatggtgtcatctaccacaagtccttccacatgttttggacca
cagtgctcggccgtcagtagtcccgtcagccagacctcatgtgctgcaactctagccaac
atcaagcgtaggaattccgtcacatgtagccctgtagagtcctgcacggttggctcaccc
ccacttacaagcccactaaatatcatgaggtctccaatgtccagccctcacagtatgagc
agtgtgaggtcccctccatcctgcagcactacatgtaacattaggtcatctgtgtcgagc
cccactggtggcagctgtaccggtgtccccaacaactgctgctcagtaagaccctcaaac
tctagtccgaccacagggggcaccttggctgtcagtagcccacataatccttcctctggt
gggttttctgaatccagtcctgctggtgggttgggtttggtgcagaacgatagcagcagc
ccagaggtcccggggctgaccagagacactaacttcaagaactttgagttccctaaagtt
gagatggtaggtggggaagtgttcagtgtcggcttagatcagatgggcatggttaagtat
attaaaaacgagccagaaagcgacttcaggagcatgtgtttaggcagctccaaatgtaat
acaagtagcacaccgtatattacacagattaagagtgaaccaaacaaaggggagggatgt
atgaatcaacagtcctacgatgagcaatcaccatcccttgatctcttccctacgtctgat
accacatatctgtccttgaggaataacattgatgaatacaatctctctgggattttagga
ccccctgtgtcctcaatgaatggaagctatgagccagatatgttttccagcaacgtcctg
tcaaagggggttaagcaagaatcaactgatggcagctatttccaagagaacaacaccatg
cccacatccgccattgttggagttaattctaccggacactcgttccattaccagattgga
gctcaaggaacgatgtcattcactcggcatgatgtgagggaccagtccaaccctttgttg
aatctaatttcacctgtaacggcgttgatggagtcgtggaaatcccgaccaggcatgcca
cacgggtcattttcagccagaggtgaagggtatccaagtcaaaactgcattggtgacaac
atgtccagctcatcactgagacaaccttcctcaacagccaaagtttgcctggtttgtgga
gacgaggcttcggggtgccactatggcgttgtgacatgtgggagctgcaaagtcttcttc
aaaagagccgtggaaggtcagcacaactacctgtgtgccgggagaaatgactgtatcatt
gacaagatcagaaggaaaaactgcccagcttgccgtgtacggaagtgtctccaggctggg
atgaacctaggagcccgcaaatccaaaaagttgaagctgaagggagtcagcgaagacctg
cagagctctaaggatggccaaactgccacaggtggcgttggaggcagttacctgacctcg
gagaaggagctaaattccagtgctgccaatgccctagtgccccacgggcctggggtggtc
acaccttttctgtcgccctccatctgcagcgtgttggagctcattgagcctgaagaggtg
tactctggctatgacaacacactgcccgacacaactgaccacttgctgtccagtctcaac
cgcctggctggaaagcagatggtacgcatggtgaagtgggccaaagtacttccaggtttc
cgggtcctgcccatagaggaccaaatcaccctgatccagtactcgtggatgtgtttgtcc
tccttttgcctcagctggcgctcctacaaacacacaaatggacagatgctctactttgcc
cctgacctcgtctttaatgaggatcggatgagacagtcagccatgtatgacctgtgtctc
ggcatgaggcaagtgagccaagagtttgttcgattgcagctgacgtatgatgagttcctc
tcaatgaaagtccttctrcttctcagcacagttcccaaagagggtctgaagaaccaggcg
gcgtttgaggagatgagggttaattacattaaagagctcagacgttcggtgggaaaagca
accaacaactccggccaaacctggcagcgcttctttcagctcaccaagctgctggacgcc
atgcatgatctggtggggaacttgttggacttctgtttctacacctttcgagagtcccag
gccttgaaggtggagtttcctgagatgttagtggagatcatcagtgaccagataccaaag
gtggaatcaggcctcactcacacaatctacttccacaagaagtga

DBGET integrated database retrieval system