KEGG   Oryzias latipes (Japanese medaka): 101155037Help
Entry
101155037         CDS       T02443                                 

Definition
(RefSeq) transforming growth factor beta-2
  KO
K13376  transforming growth factor beta-2
Organism
ola  Oryzias latipes (Japanese medaka)
Pathway
ola04010  MAPK signaling pathway
ola04060  Cytokine-cytokine receptor interaction
ola04068  FoxO signaling pathway
ola04110  Cell cycle
ola04218  Cellular senescence
ola04350  TGF-beta signaling pathway
ola04933  AGE-RAGE signaling pathway in diabetic complications
Brite
KEGG Orthology (KO) [BR:ola00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101155037
   04350 TGF-beta signaling pathway
    101155037
   04068 FoxO signaling pathway
    101155037
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    101155037
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    101155037
   04218 Cellular senescence
    101155037
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    101155037
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:ola04052]
    101155037
   00536 Glycosaminoglycan binding proteins [BR:ola00536]
    101155037
Cytokines and growth factors [BR:ola04052]
 Cytokines
  Transforming growth factors (RSTK binding)
   101155037
Glycosaminoglycan binding proteins [BR:ola00536]
 Heparan sulfate / Haparin
  Growth factors/receptors
   101155037
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TGFb_propeptide TGF_beta
Motif
Other DBs
NCBI-GeneID: 101155037
NCBI-ProteinID: XP_004073197
UniProt: A0A3P9LCU1 H2LAI7
Position
10
AA seq 420 aa AA seqDB search
MWLPCLALLLLLLRFSGVLLVDGFNTCQSINLDAQKSRRIEAVRGQILSKLRIRSPPDDD
DEPLPGGVPPEVMLLYNSTRELLKERARQAESACERESSEEDYYAKEVQRIDMLPPRTDS
NTVQPEAPSHFYRVVSFDVSGVDLTNSTLVKAEFRIFRAPNPQSRASEQRVEIYQLLRPE
EDSTSTQRYIDSRTVQPRAKGSWMSMDVTETVKDWVSDPENNLGLKLGVHCPCCTFVPST
NNIVPNKSEELEVLFAGVDDERLRQMRRPGQVKGQADYSTKTPHLILTLLPSDRVDNPAR
KSRKKRAAATDATTCSRGSDQGCCLRSLYIDFRRDLNWKWIHEPKGYKANFCAGSCPYLW
STNNHYNMILPLYNKLNPEASASPCCVPQELEPLTIMYFIGRTPRVEQLSNMVVKSCKCR
NT seq 1263 nt NT seq  +upstreamnt  +downstreamnt
atgtggctcccctgcctggcgctgctcctgctgctgctccggttctccggggttctgctg
gtggacgggttcaacacgtgtcagtccatcaacctggacgcgcaaaagtcgcggcgcatc
gaagcggtccgtggacagatcctcagcaagcttcgcatccgcagcccacccgacgacgac
gacgagcccctgccgggtggcgtgccccccgaggtcatgctgctctacaacagcacgcgg
gagctgctgaaagagcgcgcgcggcaagcggagtcggcgtgcgagcgcgaaagcagcgag
gaggactattacgccaaagaggtgcagaggattgacatgctgcccccccgcaccgactcc
aatactgtgcaaccagaagcacctagccacttttacagagtcgtctctttcgacgtcagc
ggagtcgaccttacaaacagcaccttggtaaaggctgagttcaggatctttagagctccc
aacccgcagtcccgggcctcagagcagagagtggagatctatcagttactccgacctgag
gaagatagcacctccactcaacgttacatcgactctcgcacagttcagccaagggccaag
ggaagctggatgtccatggacgtcacggaaaccgttaaagattgggtgtcagatccagag
aataaccttggactcaagctgggcgtccactgtccctgctgcaccttcgtcccatccacc
aacaacatagtgcccaacaagagtgaagagctagaagttttgtttgctggtgtggatgat
gagcggcttcgtcagatgagaagaccgggtcaggtcaaaggccaggcagattacagtacc
aagacgccacatctcatcctcaccctgcttcccagtgacagagtggacaacccggccagg
aagagccgcaagaagagggcagctgccacagacgccacgacctgctcccgtggttcggat
cagggctgctgcctacgctcgctttatatcgacttcaggcgtgacctcaactggaagtgg
atccatgagccaaaaggttacaaagccaacttctgtgccggcagctgtccttacctctgg
agcaccaacaaccactacaacatgatcctgcccctgtacaacaagctgaacccagaggcc
tccgcctccccctgctgtgttccccaggagctggagccccttaccatcatgtacttcata
ggacgcacaccacgtgttgagcagctctccaatatggttgtgaaatcctgtaagtgccgt
taa

DBGET integrated database retrieval system