KEGG   Oryzias latipes (Japanese medaka): 101155105Help
Entry
101155105         CDS       T02443                                 

Gene name
pik3c2a
Definition
(RefSeq) phosphatidylinositol 4-phosphate 3-kinase C2 domain-containing subunit alpha
  KO
K00923  phosphatidylinositol-4-phosphate 3-kinase [EC:2.7.1.154]
Organism
ola  Oryzias latipes (Japanese medaka)
Pathway
ola00562  Inositol phosphate metabolism
ola01100  Metabolic pathways
ola04070  Phosphatidylinositol signaling system
Brite
KEGG Orthology (KO) [BR:ola00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    101155105 (pik3c2a)
 09130 Environmental Information Processing
  09132 Signal transduction
   04070 Phosphatidylinositol signaling system
    101155105 (pik3c2a)
Enzymes [BR:ola01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.154  phosphatidylinositol-4-phosphate 3-kinase
     101155105 (pik3c2a)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PI3_PI4_kinase PI3Ka PI3K_C2 PI3K_rbd PX C2 DUF4135
Motif
Other DBs
NCBI-GeneID: 101155105
NCBI-ProteinID: XP_011474093
UniProt: A0A3B3IHY8
Position
6
AA seq 1725 aa AA seqDB search
MAQTPSGNGFKLDVPQPKGVVGKEEALRMEEEALAKLQREKKYTPSVSTSLPAASSTFLK
SKPSKSSTAAPEPSSSTSKPDKDLIVFSESKRQAEQDKFRDIDVHKLTNEELEDILIYEN
FDTDSIVSRPSSLLGFNLSASYPGVNACSSSHFQSGQWRSVLSTPSSSSGSTPSHQPTPL
FPSAPFPKPGTFQNGFTPAMSPFMAPPGQQATFIPFTPIQPAAAMVFPQPTVDPEMAKLF
HKIASTSEYLKNGRSTSTGLDSSKAGAASLAPNPPTPQPVVTEPSNTSNFDWLDLDPLTK
RKAENEEASLASEGPMLISAVTAGDPWDAVLESKGNTSRSSPPPEANVSLAVHSQHRRAS
TGASVTRSHSLNISETSSQHKPSNQDKGKEKALKANGAQDEEDAQNLEIAAFCKDVATLR
SKFPNDDISTNPGFVLSPVIAQRGDGGDNSNSVKVSIEISGSREPVTFTCDVSSPVELLI
SQTLCWVHDDLNQVDFSSYLLKVCGREEVLQNKHSLGSHEYVQNCRKWENEITLQLLSHS
TMRRDLARTSDDDSSRIDLEKHLGQVERPFKENVTRQGLADYLEGYHNQVNSCLQNENTQ
FKTVDRVVQTVKNLCCALDEVETRAITEAVKRLRHSANLAQSSSPKLGTTSSGQSSNGVS
GPVEESMAMLTKAVCDLAKLYLRSFCHPSPSFTSPPLPQVVEGGDATEGRGVKEASGTTD
HLQFTLFAMHGIPGTWVSSYEKYFLMCSLTHNGKNLFKPVQSKKVGTYKSFFYHIKWDEL
ISFPIAIAILPLESILSLTLFGVLNQNASGSPDSNKQRKAPELLGKVSTPLFDFRRVLAR
GTKLLGLWTSALGPAAAGPAGSRKRIPSERVVLQVDFPNSAVDVLYVGPKEVPNPDAHAL
EELDPDLRRKLEKICSRASNFGLKQTDHQLLWDYRLHCRRDHPSSLPKVLASAPSWDWAS
MAHIHSLLHHWPTLPPVAALELLDSKFADTEVRSVAVSWIEKSSDDELADYLPQLVQALK
FECHLNNALVKFLLSRAQGNINIAHYLYWLLKDAVQDPVWGQRYERVLGALLCLCGSKLR
AELEKQTHLVTLLGAVAERVKQAGGSARQVALQEGLENVQNYFQRNSCRLPLSPSLVAKE
LNIKACSFFSSNAVPLKLALVNADPLGEEINVMFKVGEDLRQDMLALQMIRIMDRMWLQE
GLDLRIVNFKCISTGKDKGMVELVPSSDTLRKIQVEYGVTGSFKDKPLAEWLRKYNPAED
EYEKASENFIYSCAGCCVATYVLGICDRHNDNIMLRSTGHMFHIDFGKFLGHAQMFGSFK
RDRAPFVLTSDMAYVINGGERPTSRFQLFVDLCCQAYNLIRKHCCLFLNLLSLMMSSGLP
ELSGSEDLKYVFDALQPHSTDAEATIFFTRLIESSLGSVATKFNFFIHNLAQLRFSGLPA
NDEPILSFSPKTYTMKQEGRILHASIFSFQKRYNPDKYYTYVVRILREGQNEPQFVFRTF
DEFQELHNKLTILFPLWKLPSFPNKMVLGRTHIKEVAAKRKVELSHYVHNLMRSSTEVIQ
CDLIYTFFHPIARDDRAEGLDATPKAPEPPMSPNSGRVEGEVKLSISYRNSTLFIMVMHI
KDLVSEDGTDPNPYVKTYLLPDPHKTSKRKTKISRKTRNPTFNEMLVYSGYSKETLGLRE
LQLSVLSAESLSENYFLGSITLRLKDFDLSKETVKWYKLTAVPYF
NT seq 5178 nt NT seq  +upstreamnt  +downstreamnt
atggcccaaacaccaagtgggaatgggttcaagctggatgtcccgcagccaaagggggtt
gtgggtaaagaggaagccctccgtatggaagaagaggctttagctaaactgcaaagggag
aagaaatacactccttcagtgtcaacatcgttgccagcagcatcgtcaactttcctaaaa
tcaaaaccatctaaatcctccactgctgctcctgaaccttcttcctcaactagtaaacca
gacaaggacctcattgtcttctcagagtccaagagacaagcagagcaggataagttcagg
gatattgacgtgcacaagttaaccaacgaagagcttgaagacattctaatttatgaaaac
tttgatactgacagcatagtgtcccggccttcatcactgctgggatttaaccttagtgca
tcctaccctggtgtcaatgcctgtagttcctcgcactttcagagtggccagtggagatct
gttctgtccaccccatctagttccagtggttccactccatcccaccagcctaccccattg
ttcccctcagccccgtttcccaaaccaggtacatttcaaaatggtttcactccagcaatg
tcacctttcatggctccaccaggacagcaggcaactttcatacccttcactcccatccaa
cctgctgccgctatggtcttcccacagccaactgtagacccagagatggccaagttgttt
cacaaaattgccagcacctcagaatacttgaagaatggcagatcaaccagcaccggcttg
gattcttcaaaagcaggagcagcttctctggcacctaacccaccaaccccacagccagtg
gtgacagaaccctctaacaccagcaactttgactggctcgatctggaccctctcacaaag
cgcaaagctgagaatgaggaggcatctctggcatcagaaggacctatgctgatatcagca
gttactgcaggagacccgtgggatgcggtccttgagtctaaagggaatactagtagaagc
agcccccctccagaggcaaacgtgtcacttgcagttcactcacagcacaggagagcatcg
acaggagcatctgtcacccggagtcactcgctcaacatctcggagacatcgtcccagcac
aaacccagcaatcaggacaaaggaaaagaaaaagctttaaaggcaaacggtgcccaggat
gaggaggatgcacaaaacctggagattgctgccttttgtaaagatgtggcaaccttgcgc
tccaaattccctaatgacgacatttccacaaacccgggcttcgtccttagcccggttatc
gctcagaggggcgacgggggcgacaacagtaactctgtcaaagtttccatcgaaatttct
ggatctcgggagccggtaaccttcacctgtgatgtgagttctccagtggagctcctgata
agccagactctctgctgggtccatgatgacctgaaccaagtggacttctccagttatttg
ctcaaagtctgtggtcgggaggaagtgctgcagaacaaacacagccttggcagccatgag
tatgtccagaactgcaggaagtgggagaatgagatcacattgcaactgctttctcactcc
acaatgaggagggacttggcacgcacttctgacgatgacagctcccgaatagatttagag
aaacacctggggcaggtagagaggcctttcaaggagaatgtcaccagacaagggcttgct
gactatttggaaggatatcacaatcaagttaacagctgtttgcaaaatgagaatactcag
tttaagacagtggacagggtggtgcagactgtgaagaacctctgctgtgctttagacgag
gtggagactcgagctattacagaggcagtcaaaagactacgccattctgccaacctggcc
cagtcaagctcaccaaagttggggaccacatcctctggtcagtcatccaatggtgtctcc
ggccctgtggaggagagcatggccatgctaacaaaggccgtctgtgaccttgccaagctg
tacctgcgctccttttgtcacccgtcgccttctttcacctcccctcctctgccccaggtt
gtagaaggaggggacgccacagaggggaggggtgtcaaagaagcttctggaacaacagat
catctgcagttcactctgtttgccatgcacggcatcccaggcacatgggtcagcagctat
gagaaatacttcctgatgtgttcccttacccacaatggaaaaaacctgttcaaaccagtc
cagtccaagaaagtgggcacgtacaaaagcttcttctaccacatcaaatgggatgaattg
ataagtttccccatagcaatagccatactcccactggaatccatactgagcctgactctg
tttggggtgctaaaccagaatgccagcggctctccagactccaacaaacagaggaaagcc
ccagagcttctgggtaaagtgtccacacccttgtttgacttcagacgagtacttgcacgt
ggcaccaagctgctgggtctgtggacttctgcactgggacctgctgctgccgggcctgca
ggtagtcgcaagagaataccttcagaaagagtagtattacaggtggatttcccaaactcg
gccgtggatgttttatacgttggacccaaagaggtccccaaccctgacgctcacgcactg
gaggagctggatccagacctccgccgcaaactggagaaaatctgcagccgagcatctaat
tttggactgaaacagaccgatcatcagctcctgtgggactaccggctccactgtcgcagg
gaccaccccagcagcctccccaaggtgttggccagtgcacccagctgggactgggccagc
atggctcacattcactccctgctgcaccactggcccaccctgccccctgtcgctgcgctg
gagctgcttgactcaaagtttgcagacactgaggtgagaagtgtggctgttagttggatc
gagaagagctctgatgatgaactagctgactacctgccacaactagtacaggcattaaag
tttgagtgtcacttaaacaatgccctcgttaagttcctcctatccagagcacaaggaaac
atcaatatagcacattatctctactggctgctgaaggatgctgtgcaagatcctgtctgg
ggacagcgatatgagcgggtgctgggtgccctgctttgtctgtgtggaagcaagttgagg
gcggagcttgagaaacagactcacctggttactctgctgggcgctgtggcagagagggtc
aaacaggctggaggttctgcacgacaggtcgcactgcaggaaggccttgaaaatgttcag
aactatttccagaggaacagctgccggcttcctctcagccccagtctggtggcaaaggag
ctaaatattaaggcctgctcctttttcagctcaaacgcagttcccctcaagctggccctg
gtcaatgctgacccactgggagaggagatcaatgtcatgtttaaggtgggggaagacctg
cgacaggacatgctggctcttcagatgattcgcattatggaccgcatgtggctgcaggaa
gggctggatcttcgcatcgttaacttcaagtgcatctccaccgggaaagacaaaggtatg
gtggagctggtaccgtcttcagacaccctgagaaagattcaggtggagtatggcgtcact
ggatcctttaaagacaaacctcttgcagaatggcttcgcaaatacaaccctgcagaggat
gaatacgagaaggcatcagagaacttcatctactcctgtgcagggtgctgtgttgcaaca
tacgtgcttggcatctgtgatcgtcataatgacaacataatgctgcgctccactggtcac
atgtttcacattgactttgggaagttcctgggacatgcccagatgtttggcagcttcaaa
agagaccgggcgccgtttgttctgacatctgacatggcatacgtcatcaacggaggcgag
cgccccaccagccgcttccagctgtttgtggacctctgctgccaagcctacaacctcatt
cgcaagcactgctgccttttccttaacctgctgtctctgatgatgtcatcaggcctcccc
gagctgtccggctctgaagatctgaagtacgtgttcgatgcccttcagcctcacagcacc
gacgctgaggccacaatcttcttcacaaggctcatagagtccagtctgggaagtgtggcc
acaaaatttaacttcttcatccacaaccttgcccagctgagattttctggccttcctgcc
aatgatgagccaatcctgtctttctccccaaaaacatacacaatgaagcaggaggggcgt
atcctccacgcatccattttctctttccagaagagatacaaccctgacaagtattatact
tacgtggtgaggattctcagggaaggtcagaatgagcctcagtttgtcttccgcaccttt
gatgagtttcaagagctccacaataaactcaccattctttttcctctgtggaagctgcca
agtttcccaaacaaaatggtgctcggtcgcacacacattaaggaggtggcagccaagagg
aaggtggagctcagccactatgtccacaacctgatgaggagctccactgaggtcatccag
tgtgacttgatctacaccttctttcatcctattgcacgagatgacagggcagaaggttta
gatgccacgcccaaagcacctgagcctccaatgagtcctaattcagggcgggtggaggga
gaagtgaagctctccatctcttacaggaatagcacgctcttcatcatggtcatgcacatt
aaggacctggtttctgaagatggaacagatcccaacccatatgtgaaaacctacctgctt
ccagatccacacaagacctccaaacgaaagacgaagatctccaggaaaactagaaacccc
accttcaatgagatgctggtgtacagcggctacagcaaagaaacgcttggactgcgggag
ctgcaactgagcgtgctcagtgctgagtcactgagtgaaaactactttctgggcagcatc
acgctcagactcaaagactttgacctcagcaaagagacggtcaagtggtacaaactgaca
gcagttccctacttctaa

DBGET integrated database retrieval system