KEGG   Oryzias latipes (Japanese medaka): 101155544Help
Entry
101155544         CDS       T02443                                 

Definition
(RefSeq) aldehyde dehydrogenase family 9 member A1-B
  KO
K00149  aldehyde dehydrogenase family 9 member A1 [EC:1.2.1.47 1.2.1.3]
Organism
ola  Oryzias latipes (Japanese medaka)
Pathway
ola00010  Glycolysis / Gluconeogenesis
ola00053  Ascorbate and aldarate metabolism
ola00071  Fatty acid degradation
ola00280  Valine, leucine and isoleucine degradation
ola00310  Lysine degradation
ola00330  Arginine and proline metabolism
ola00340  Histidine metabolism
ola00380  Tryptophan metabolism
ola00410  beta-Alanine metabolism
ola00561  Glycerolipid metabolism
ola00620  Pyruvate metabolism
ola01100  Metabolic pathways
Module
ola_M00135  GABA biosynthesis, eukaryotes, putrescine => GABA
Brite
KEGG Orthology (KO) [BR:ola00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    101155544
   00053 Ascorbate and aldarate metabolism
    101155544
   00620 Pyruvate metabolism
    101155544
  09103 Lipid metabolism
   00071 Fatty acid degradation
    101155544
   00561 Glycerolipid metabolism
    101155544
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    101155544
   00310 Lysine degradation
    101155544
   00330 Arginine and proline metabolism
    101155544
   00340 Histidine metabolism
    101155544
   00380 Tryptophan metabolism
    101155544
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    101155544
Enzymes [BR:ola01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     101155544
    1.2.1.47  4-trimethylammoniobutyraldehyde dehydrogenase
     101155544
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aldedh DUF1487
Motif
Other DBs
NCBI-GeneID: 101155544
NCBI-ProteinID: XP_004079042
UniProt: H2M419
Position
17
AA seq 517 aa AA seqDB search
MLQRLAASSRWRAAVLATSAARCLSSGSVTITDPLNYWAGRRKAGQEKCSTENVYEPATG
RILCHLELCGGDEVNQAVKAAKSAFGYWSKMSGMERARIMINAAHIMESRREEIAEMEVV
NNGKSITEARLDVDSARLCIEYYAGLASTLAGQHVQLAGGSFAYTRREPLGVCAGIGAWN
YPFQIAAWKSAPALACGNSMVFKPSPVTPVTAVLLAEIYAKAGAPEGLFNVVQGGQETGS
LLCHHPDVAKVSFTGSVPTGQKIMEMASKGIKPVTLELGGKSPLIIFEDSDVENAVKGAL
MANFLSQGQVCSNGTRVFVQKDILPEFVDVVVKRTKAISIGDPLLESTRMGALVSRPHLD
KVLSYVQQAKAEGATVLCGGEPFVPSDPKLRGGYYMSPCVLGDCTDDMTCVKEEIFGPVM
SVLSFETEEEALQRANDTTLGLAAGIFTRDVKRAHRVVEHLKAGSCFINNYNVTPVEVPF
GGFKMSGIGRENGQVTIEFYSQMKTVFVEMGDVDSLF
NT seq 1554 nt NT seq  +upstreamnt  +downstreamnt
atgcttcagaggctggctgcgtcctcacggtggcgggcggccgtccttgccacctcggcc
gcacggtgcctctcttccggctcggtaaccatcacagaccccttgaactactgggcaggg
cggaggaaggctggtcaagaaaaatgcagcacggagaatgtttacgaaccagcaacagga
cgcatcttgtgccatttggaactttgtggcggtgatgaggtcaatcaggctgtcaaggct
gccaagtcagcgtttggctactggagcaaaatgtctgggatggagagagcgaggatcatg
atcaatgctgcccacataatggagagcaggagagaggagattgctgagatggaggtggtc
aacaatgggaagtcgatcacagaagcccgtctggatgtggactctgcaaggctgtgcata
gaatattatgcaggactagccagtactctggcaggccagcatgtccagttagccggagga
tccttcgcctacacccgcagggagcccctgggagtgtgtgctggcatcggggcttggaat
tacccctttcagatcgctgcatggaagtcagctccagccctggcctgtggtaactccatg
gtttttaaaccgtcaccggtgactcctgtgacggcggtcttactggcagagatttatgca
aaggccggcgccccggaggggctgtttaacgtggtccaggggggtcaggagactggcagc
ctgctctgccatcaccctgatgtagccaaggtgtctttcaccgggagcgtgcccacggga
cagaagatcatggagatggcatcaaaggggatcaaacctgtgacgctggagctgggaggg
aaatccccgctgattatttttgaggacagcgatgtggagaatgccgtgaagggggccctt
atggccaacttcctctctcaaggccaggtctgcagcaacggtacgcgggttttcgtgcag
aaggacatcctgcctgagtttgtggacgtggtggtgaaaagaacaaaagccatttccata
ggagaccctttgttagagagcaccagaatgggagcgctggtcagcagaccccacctggac
aaagtcttatcgtatgttcagcaggcaaaagcagagggagccacagtgttgtgtggagga
gaaccttttgtcccatcagatcccaaactcagaggtggatactacatgagtccgtgtgtt
cttggggactgcacggatgacatgacctgtgtgaaggaggaaatctttggtccagtcatg
tctgtgctgtccttcgaaacagaagaggaggcgttgcagagagccaacgacacgacactg
ggactggctgctggcatcttcaccagggatgtgaagcgagcccacagagtggttgagcac
ctaaaggccggctcctgtttcatcaacaactacaacgtcactcctgtggaggtgccgttt
ggaggcttcaaaatgtcaggtataggacgggagaacggccaggtgacgattgagttctac
tcccagatgaagacggtgtttgtggagatgggagatgtggacagcctgttctag

DBGET integrated database retrieval system