KEGG   Oryzias latipes (Japanese medaka): 101155547
Entry
101155547         CDS       T02443                                 

Gene name
ankrd53
Definition
(RefSeq) ankyrin repeat domain-containing protein 53
  KO
K21441  ankyrin repeat domain-containing protein 53
Organism
ola  Oryzias latipes (Japanese medaka)
Brite
KEGG Orthology (KO) [BR:ola00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:ola03036]
    101155547 (ankrd53)
Chromosome and associated proteins [BR:ola03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Spindle formation proteins
    101155547 (ankrd53)
SSDB
Motif
Pfam: Ank_2 Ank_4 Ank_5 Ank Ank_3
Other DBs
NCBI-GeneID: 101155547
NCBI-ProteinID: XP_004079900
Position
18
AA seq 373 aa
MESAATAGKRRRGTCRRLSRKVKSTSTQMRPAAAARSSAELENSQVLPALHRACFHGDLA
SVGLLVNSKQWNINNTDLQGHQPIHMALFLQGFPNNSACLRYLLEHDADVNAITDRGQTP
LHLAASTGLLDCAEVLVNAGADVSAKDNRGYTPLDLARIWSHRKMARYLKNCLWQENKKT
EMEERKLAQALYRDLVTQAKRDTFNKKGLVNEKTAEWANKKGLKNVTSRMHPSKYHTRCL
FSDQSRSKPKSYGRLQQKRDPQEDNTAPPKTPTCGSSSPWSIFMGVQPEKPSAEPDLRHS
VTLFFHRNTRQLFYTTKWDSEPHPIPKLPLDVVERVLFPRAFRSRIFGPECFVPQKIDEI
QHRGRPQRRQKRT
NT seq 1122 nt   +upstreamnt  +downstreamnt
atggaatccgccgccacagctggtaaacgaagacgtggaacatgcaggagactgtcccgc
aaagttaagtccacgtccacgcagatgaggcctgctgctgctgctcggagctcagcggag
ctggagaacagtcaggttttgccagctctccatagagcctgctttcatggagacctggct
tctgttggactcttggtgaactccaagcaatggaacatcaacaacactgatctacagggt
caccagccaattcacatggctctgtttctgcaaggtttccccaacaactccgcctgcctc
agatacctgctggagcatgatgctgatgtcaatgccatcactgacagagggcagaccccg
ctccacctggctgcctccacaggcctcctggactgcgcagaggtccttgtgaacgctgga
gcagatgtttccgcaaaagacaacagaggatatacacctttggatttggcccgtatctgg
agccacagaaaaatggccaggtatctgaaaaattgcttgtggcaggaaaataagaagaca
gaaatggaggagagaaagctggctcaagctttatacagagatcttgtaacacaggccaaa
agggatacattcaataaaaaggggcttgtcaatgagaagacagcagaatgggcaaacaag
aaaggcctgaaaaatgtcacttctaggatgcatccaagcaagtaccacaccagatgcctg
ttctcagaccagagccgttcaaaaccaaaatcttatgggagactgcagcagaaaagagac
cctcaggaagacaacactgccccccctaaaacaccaacatgtggatcttccagtccctgg
agcattttcatgggcgtgcagccagagaaaccatctgcagagccagatctgagacacagt
gtcaccttgttttttcacagaaataccaggcagcttttctataccactaaatgggacagc
gagcctcaccccatccctaaacttcctttggatgttgttgagagggtgttgttccccagg
gccttccgctcaaggattttcggaccagaatgctttgtgccgcagaaaattgatgagatc
cagcatcgggggcggccgcagcggagacagaagcggacataa

DBGET integrated database retrieval system