KEGG   Oryzias latipes (Japanese medaka): 101155585Help
Entry
101155585         CDS       T02443                                 

Definition
(RefSeq) very long-chain acyl-CoA synthetase
  KO
K08746  solute carrier family 27 (fatty acid transporter), member 2 [EC:6.2.1.- 6.2.1.3]
Organism
ola  Oryzias latipes (Japanese medaka)
Pathway
ola03320  PPAR signaling pathway
ola04146  Peroxisome
Brite
KEGG Orthology (KO) [BR:ola00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    101155585
 09150 Organismal Systems
  09152 Endocrine system
   03320 PPAR signaling pathway
    101155585
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:ola01004]
    101155585
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:ola02000]
    101155585
Enzymes [BR:ola01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.3  long-chain-fatty-acid---CoA ligase
     101155585
    6.2.1.-  
     101155585
Lipid biosynthesis proteins [BR:ola01004]
 Acyl-CoA synthetase
  Long/very long chain acyl-CoA synthetase
   101155585
Transporters [BR:ola02000]
 Solute Carrier Family (SLC)
  SLC27: Fatty acid transporter
   101155585
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: AMP-binding AMP-binding_C
Motif
Other DBs
NCBI-GeneID: 101155585
NCBI-ProteinID: XP_023809040
Position
3
AA seq 615 aa AA seqDB search
MIAYVLCTVVALWAALLYLRNPYLLADINYAIKSLYVGYRLGQIKRRFYGILDCFLDRVA
KHPDKKLFIFEDVSYTYKQADAESNKVARALSAHAQLKPGDTVALFLGNEPLLVWVWLAL
AKLGCVTALLNYNIRSRSLLHCFSCCGAKILITSPDLREAVEEVLPTLREQGIRVLVLGD
HLEADGFESLFHKVQEASDQPLSPELRANIHHKSPALYIYTSGTTGLPKAAIITHQRAWS
ASLAQEMVGVRSDDIFYLYLPLYHTAGFLMGLCGGINKGVTFVLKRKFSVSSFWDDCRKY
NITVIQYIGEIMRYLCNMPKKDNDKDHNVRLAFGNGIRTDTWAEFLERFGNIQICECYGA
TEANIGFINYVGKIGALGRENFLHKMSNKYALIRYDTEKEQPFRNAEGFCVEVPKGETGL
LVSMIGAATPFVGYANNQQQTERKILKDVFVTGDLYLNSGDLLRIDREGFVYFQDRTGDT
YRWKGENVATTEVADQLLMVDFVEEANVYGVKVPGHEGRIGMAALKLKENMVFDGRAIYQ
CVKSNLPGYARPRFIRIQDALSVTETFKHMKVKLAEEGFNPATIKDPLYFLEDNESYISM
TQEIFDSISEGKVRL
NT seq 1848 nt NT seq  +upstreamnt  +downstreamnt
atgattgcgtacgtcctgtgcaccgttgtagcactttgggccgcacttctttacctgcgg
aacccctatttgttggcggacataaattacgcaatcaagtcgctttacgtgggttaccgt
ttggggcagataaagaggcgcttttacggcattctggactgttttctggacagagtagcg
aagcatccagacaagaagttgttcattttcgaggatgtctcctacacttataaacaagca
gacgcagagagcaacaaggtggcccgggctctgtctgcgcacgcgcagctgaagccgggg
gacacggtggcgctgttcctgggcaacgagcccctgctcgtgtgggtctggctggctttg
gccaagctgggctgcgtgacggctctgctgaactacaacatccggtccagatctctgctg
cactgcttctcctgctgtggagccaaaatcctcatcaccagccctgacctgagggaagct
gtggaggaggtgttacccacgctgagggagcagggcatccgtgtgcttgtcctcggtgat
catcttgaagcagatggctttgaaagcctctttcataaggttcaggaggcgtcagaccag
cctctgtcacccgagctgagggcaaacattcaccacaagagtcctgcactgtacatctac
acctcagggaccacagggcttcccaaagctgccataatcacccaccagagggcatggtca
gcatctttggctcaggaaatggttggtgtgcgctcagacgacatcttctacctttacctg
cctctttaccacaccgcaggttttctgatgggactctgtggaggaatcaacaaaggcgtc
acttttgttttaaagcgtaaattctcagtgtccagcttctgggatgactgtcggaaatac
aacatcactgtcattcagtacataggagagattatgcgttacctctgcaacatgccaaag
aaagacaatgacaaggaccataatgtgcgactagcgtttggtaacgggataaggacggac
acctgggctgaattcctggaacgcttcggaaacattcaaatctgcgaatgctatggagcc
accgaagcaaatatcggctttatcaactacgttggaaaaattggagctctgggtagagag
aactttctccacaaaatgtcaaataaatacgccctcatcagatatgatacggagaaagag
cagccattcagaaacgcagagggattctgtgttgaagtcccaaaaggggaaactggcttg
ttggtctcaatgataggagccgccaccccctttgttggctacgctaacaaccagcagcag
acggagagaaagatattgaaggatgtctttgtgacaggagacctctacctaaacagcggt
gaccttttgaggatagaccgcgagggatttgtttacttccaggaccgcactggagacact
tacaggtggaaaggagaaaatgtggcgaccacagaggtggcagatcaattgctcatggtg
gactttgttgaggaggctaatgtctacggcgtgaaagtgccaggacatgagggaaggatt
ggaatggctgccctgaagctgaaggaaaatatggtgtttgatggcagagctatatatcag
tgtgtcaagagcaacctgcccggctacgccaggccacgtttcatacgcatacaggatgct
ctgtcagtgactgaaacgtttaagcacatgaaggtgaagctggccgaggaaggcttcaat
cccgctaccatcaaggaccccctgtacttcctggaagacaacgaaagctacatatccatg
actcaggaaatattcgactccatttcagagggaaaagtcaggctttga

DBGET integrated database retrieval system