KEGG   Oryzias latipes (Japanese medaka): 101155724Help
Entry
101155724         CDS       T02443                                 

Gene name
prodh2
Definition
(RefSeq) hydroxyproline dehydrogenase isoform X1
  KO
K11394  hydroxyproline dehydrogenase [EC:1.5.5.3]
Organism
ola  Oryzias latipes (Japanese medaka)
Pathway
ola00330  Arginine and proline metabolism
ola01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ola00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00330 Arginine and proline metabolism
    101155724 (prodh2)
Enzymes [BR:ola01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.5  With a quinone or similar compound as acceptor
    1.5.5.3  hydroxyproline dehydrogenase
     101155724 (prodh2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pro_dh HTH_1
Motif
Other DBs
NCBI-GeneID: 101155724
NCBI-ProteinID: XP_023805012
Position
19
AA seq 480 aa AA seqDB search
MLCSRLSPSSFHLSPLRLLGTAASRTVGFKQAELHPTALNFEDPSAFRVKSLRELLRALT
VFRLCSFPVLVNNCGKLMSTARSILGRKAFSLLLRPTVYAQFVAGENESEISQSMEKMSL
LGLRPMLAVPMEEDLGESTGERRYDDNMAIMLECVRMSHSNAWCKDPMMQLKVTALLNPE
LCVKLTAVIAQQPYDLDLLVRAMDGEHVTFPGLDQKEGTHLMHGLQRLDKIAKASINNVR
VLVDAEYTYMNPALSLVTMAMMKKYNRDSAWIWNTYQCYLKESRSLLLEALSLSKREGFC
LGVKLVRGAYMDKERKLAEKEGRVDPIHQSWEDTNDSYNGCLDVMLRTISQNPERYRIIV
ASHNEESVRRAAKRQTSNPPGCWYSISRMEELHIDKDRGSVCFGQLLGMCDYVSLTLAKE
GYAVYKSVPYGSVDDTIPYLVRRAQENRTVLQGIRKERDLLRREFKHRVGGILRGGGGGS
NT seq 1443 nt NT seq  +upstreamnt  +downstreamnt
atgttgtgctctcgtttgagcccatcttcatttcacctctcgccactgaggctcctgggt
accgcagcctccaggacagttgggttcaaacaggcggagcttcatcccactgctctgaac
tttgaggatcccagcgccttcagggtgaagagtttgagagagctgctccgggctttgacc
gtcttccgtctttgctcatttccagtgttggtcaacaactgtggaaagcttatgtccaca
gcgcgcagcattctcggaagaaaggccttctccttgctgctgcggcccacagtttacgct
cagtttgtagccggcgagaacgaaagcgagatctctcaatccatggagaagatgagcctg
ttgggactgaggcccatgctggctgtccctatggaggaagacctcggagagagcaccggg
gagagacggtacgacgacaacatggcgatcatgctggagtgtgtgcggatgtcccacagc
aacgcctggtgcaaagacccaatgatgcagctaaaggtcacggctctgctcaacccagag
ctgtgtgtgaaactcacagccgtcattgcgcaacaaccgtacgatctagatctgcttgtc
agagccatggacggagagcacgttaccttccctggtttggaccaaaaagagggcactcac
ctgatgcacggcctgcagagacttgacaaaatagcaaaggcaagtataaataacgttcga
gtcctggtggatgctgagtacacatacatgaaccccgccctgtctctggtcaccatggcg
atgatgaagaagtacaacagggatagtgcttggatttggaacacgtatcagtgttatctg
aaggagtccagatctctgctgttggaggctctgagtttgtccaaacgggaaggtttctgt
ttgggcgtgaagctggtgcgaggagcttacatggacaaagagaggaagctggcggagaaa
gagggacgcgtcgacccaatccatcaaagctgggaggacaccaatgacagctacaacggc
tgcttggatgtgatgctgaggaccatttcccagaatcctgagcgctaccggatcatagtg
gcctcacacaatgaggagtcagtgagacgagctgccaaacgccaaacttcaaaccctcct
ggttgttggtattccatctccaggatggaggagctgcacatcgacaaagaccgaggctcg
gtgtgtttcggtcaactgctgggcatgtgtgattatgtctccctcacactggctaaggag
ggctacgccgtgtacaagtcggtgccgtacggttcagtggacgacaccatcccttacctg
gtgcgccgggctcaggagaaccgcacggtgctgcagggaattcgcaaagagagggatttg
ttgaggagggagttcaaacatagagttggggggattctgaggggggggggggggggtagc
taa

DBGET integrated database retrieval system