KEGG   Oryzias latipes (Japanese medaka): 101155932Help
Entry
101155932         CDS       T02443                                 

Gene name
kat8
Definition
(RefSeq) histone acetyltransferase KAT8 isoform X1
  KO
K11308  histone acetyltransferase MYST1 [EC:2.3.1.48]
Organism
ola  Oryzias latipes (Japanese medaka)
Brite
Enzymes [BR:ola01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     101155932 (kat8)
Chromosome and associated proteins [BR:ola03036]
 Eukaryotic Type
  Histone modification proteins
   HATs (histone acetyltransferases)
    101155932 (kat8)
   HAT complexes
    NSL complex
     101155932 (kat8)
    MSL complex
     101155932 (kat8)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MOZ_SAS Tudor-knot Acetyltransf_7 HTH_9
Motif
Other DBs
NCBI-GeneID: 101155932
NCBI-ProteinID: XP_004071166
Position
8
AA seq 495 aa AA seqDB search
MTGGSAFHKNYSNNKDSEPRIGVEMDSSRPEHERGELESSMPAACSSNGSGGEEDEAEAH
GRTREAGASSNQHTPEGGGVLCGGREQEVSVEIGVTYLCQRADKTWHTAEVIQSRLNEQE
GREEFYVHYVGFNRRLDEWVGKSRLALTKTVKDAVRKSTEVGGVGDLGDQPERKITRNQK
RKHDEINHVQKTYAEMDPTTAALEKEHEAITKVKYVDKIQIGNFEIDAWYFSPFPEDYGK
QPKLWICEYCLKYMKYEKTFRYHLSHCQWRQPPGKEIYRRSNISVYEVDGRDHKIYCQNL
CLLAKLFLDHKTLYFDVEPFIFYILTEVNKQGAHIVGYFSKEKESPDGNNVACILTLPPY
QRRGYGKFLIAFSYELSKLENSVGSPEKPLSDLGKLSYRSYWSWVLLEILRDFRGTLSIK
DLSQMTSITQSDIISTLQSLNMVKYWKGQHVICVTPKLVEEHLKSAQYKKPPITVDTLCL
KWAPPKNKQAKLSKK
NT seq 1488 nt NT seq  +upstreamnt  +downstreamnt
atgacgggcgggagcgcctttcacaagaactacagcaacaataaggactcggaaccccga
atcggtgtggaaatggactcgagtcgacccgagcacgagcggggggagctggaaagcagc
atgcccgccgcgtgctcctccaacggcagcggcggggaggaggacgaggcggaggcccac
ggccggacacgagaagccggggcctcgagtaatcagcacaccccggagggaggcggggtg
ctctgcggcgggagggagcaggaggtgtcggtggaaatcggagtgacgtatttgtgtcaa
agagcggacaaaacatggcacacagcggaggtgatccagtcccggctgaacgagcaggag
ggcagggaggagttctacgtgcactacgtgggcttcaaccgccgtctggacgaatgggtg
ggaaagtcccgcctggcgctgaccaagacggtgaaggacgccgtgaggaagagcactgag
gttggaggcgttggggatctgggagaccagcctgagaggaagatcacacgcaaccagaag
cgcaagcacgatgagatcaaccacgtgcagaagacgtacgcagagatggacccgacgaca
gccgcactggagaaggagcacgaagcgatcaccaaagtgaaatacgtggataaaatccag
ataggaaactttgaaattgacgcctggtacttctctccatttcctgaagactacgggaag
cagcccaagctgtggatctgcgagtactgtctcaaatacatgaagtacgagaagacgttc
agatatcacctgtctcactgtcagtggaggcagccccccggcaaggagatctacaggcgg
agcaacatctccgtgtacgaggtggacgggcgggaccacaagatttactgtcagaatctc
tgtcttctggccaaactgttcctcgaccataagacgctttattttgacgtggagcccttc
atcttctacatcctcactgaggtcaacaagcagggggcgcacatcgtcggctacttctcc
aaagagaaggagtctccggatggaaacaacgtggcgtgcattctcacgctgccgccttac
cagcgcagaggttatgggaagttcctcatcgctttcagttatgagctctctaagctggag
aactcggtgggttcccctgagaaaccgctgtcggatctggggaagctgagctacaggagt
tactggtcctgggtgctgctggagatcctgcgggacttcagaggaactctgtccatcaaa
gacctcagccagatgaccagcatcacgcagagtgacatcatcagcacgctgcagtcgctc
aacatggtgaagtactggaagggtcagcacgtcatctgcgtgacccccaagctggtggag
gagcacctgaagagcgcccagtacaagaaaccccccatcacagtggacactttgtgctta
aagtgggcccctcccaagaacaaacaagccaaactgtcaaagaagtaa

DBGET integrated database retrieval system