KEGG   Oryzias latipes (Japanese medaka): 101157232
Entry
101157232         CDS       T02443                                 

Gene name
dck
Definition
(RefSeq) deoxycytidine kinase
  KO
K00893  deoxycitidine kinase [EC:2.7.1.74]
Organism
ola  Oryzias latipes (Japanese medaka)
Pathway
ola00230  Purine metabolism
ola00240  Pyrimidine metabolism
ola01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ola00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    101157232 (dck)
   00240 Pyrimidine metabolism
    101157232 (dck)
Enzymes [BR:ola01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.74  deoxycytidine kinase
     101157232 (dck)
SSDB
Motif
Pfam: dNK AAA_18 AAA_33 AAA_28 AAA_17 Thymidylate_kin
Other DBs
NCBI-GeneID: 101157232
NCBI-ProteinID: XP_004074563
Position
12
AA seq 267 aa
MPFNPKRPCPEPMNDSMNDSMEKRIKRISIEGNIAAGKSTFVRLLEQESADWEVVPEPIA
RWCNVQTSGNDFEELTASQRSGGNVLQMMYEKPERWAYTFQSYACISRVRAQIKSANGKL
RDAENPVQFFERSIYSDRYIFAANLYESSCLNETEWSVYQDWHGWLHKQFGKHIELDGII
YLRASPEKCLERLHLRGRQEEQDIPLEYLEKLHFKHESWLQHKTMNMDFEYLKDVPVLTI
DVNEDFKESENKSADMIEKVKEFLNTL
NT seq 804 nt   +upstreamnt  +downstreamnt
atgccttttaatccgaaaagaccgtgccccgaaccaatgaacgactccatgaacgactcg
atggagaaaaggataaagcgcatttccatcgagggcaacatcgcggctggaaagtcgacg
tttgtgcgccttttggagcaggagagcgcggactgggaggtagtaccggagcccatcgct
aggtggtgcaacgtccaaacatcagggaacgactttgaggagctgactgcatctcaaaga
agtggaggaaatgtcctgcagatgatgtacgagaagccagagaggtgggcctacaccttc
cagagctacgcctgcatcagccgggtccgagcgcagattaaatccgccaacgggaagctt
cgggacgctgaaaaccccgtgcagtttttcgagcgatccatctacagcgaccgatacatt
tttgcagccaacctgtatgagagttcatgcctgaatgagacggagtggtctgtgtaccag
gactggcacggctggctgcacaaacagttcgggaagcacatcgagctggatggcatcatc
tacctcagagcttcaccggagaaatgtttggagagattgcacctgagaggcaggcaggag
gagcaggacatccccctggagtacctggagaagctccacttcaaacacgagagctggctg
cagcacaaaaccatgaacatggattttgagtatctgaaggacgttccggtcctgaccatc
gacgtgaacgaagactttaaagaaagcgagaacaagagcgccgacatgatcgagaaggtg
aaggagttcttgaacactttgtga

DBGET integrated database retrieval system