KEGG   Oryzias latipes (Japanese medaka): 101157760
Entry
101157760         CDS       T02443                                 

Gene name
gtf2f2
Definition
(RefSeq) general transcription factor IIF subunit 2 isoform X1
  KO
K03139  transcription initiation factor TFIIF subunit beta [EC:3.6.4.12]
Organism
ola  Oryzias latipes (Japanese medaka)
Pathway
ola03022  Basal transcription factors
Brite
KEGG Orthology (KO) [BR:ola00001]
 09120 Genetic Information Processing
  09121 Transcription
   03022 Basal transcription factors
    101157760 (gtf2f2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:ola03021]
    101157760 (gtf2f2)
Enzymes [BR:ola01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     101157760 (gtf2f2)
Transcription machinery [BR:ola03021]
 Eukaryotic type
  RNA polymerase II system
   Basal transcription factors
    TFIIF
     101157760 (gtf2f2)
SSDB
Motif
Pfam: TFIIF_beta TFIIF_beta_N
Other DBs
NCBI-GeneID: 101157760
NCBI-ProteinID: XP_004067132
UniProt: H2LHH8
Position
3
AA seq 267 aa
MSEKSDVDLTGAKLNTGVWLVKVPKYLAQQWAKATGRGEVGKLRIIKKGNLGKPEVSFTL
NEELTIIEGIEDKTVSAPRDHPFTMQSVGGQMLAVFTESSSGQSEERSDGSSSGAGSGPD
KIALEGVVVQRAECRPAVSESYMKLKRLQIEESSKPSRLSQQLSKPVTNYKPVANHEYNR
EYEKKKKEEGKRARADKQQVLEMLFSAFEKHQYYNIKDLVDITKQPVIYLKEILRDIGIY
NVKGTHKNTWELKPEYRHYQPGEKTDE
NT seq 804 nt   +upstreamnt  +downstreamnt
atgtcagaaaaaagtgacgttgatttaacaggtgctaagctgaacacgggtgtgtggctt
gtgaaggtacccaaatacctggcacagcaatgggcaaaagcaacgggcagaggcgaggtc
gggaagctccgaatcatcaagaaaggaaatctgggaaaaccagaggtgtccttcactttg
aacgaagagctgaccatcattgaaggtatagaggataagacggtgtctgcgccgcgtgat
catcctttcaccatgcagtcagtgggaggacagatgctggccgtcttcacagagagttca
tctggccagtcagaagaaagatctgatggcagcagctcaggggcggggtcaggtccagat
aaaatcgccttggagggagttgtggttcagagagcggagtgcagacctgcggtcagtgaa
agctacatgaaattgaagaggttacaaattgaggagtcctccaaaccatccaggctctcg
cagcagttgtcaaaacctgtcaccaactacaaacctgtggccaaccatgagtacaatcgc
gagtacgagaagaagaagaaagaggaaggcaagagggcgagagctgacaaacagcaggtt
ttggaaatgctgttctctgcttttgagaagcaccagtactacaacatcaaagacctggtg
gatatcactaaacagccagtgatctaccttaaagaaatcctgcgtgacattggcatctac
aacgtgaagggaacccacaagaacacctgggagctcaaaccagaatacaggcattaccag
cctggagaaaagactgatgaatag

DBGET integrated database retrieval system