KEGG   Oryzias latipes (Japanese medaka): 101158359Help
Entry
101158359         CDS       T02443                                 

Definition
(RefSeq) transcription elongation factor A protein 2 isoform X1
  KO
K03145  transcription elongation factor S-II
Organism
ola  Oryzias latipes (Japanese medaka)
Brite
KEGG Orthology (KO) [BR:ola00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:ola03021]
    101158359
Transcription machinery [BR:ola03021]
 Eukaryotic type
  RNA polymerase II system
   Other transcription-related factors
    Transcription elongation factors
     101158359
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TFIIS_M TFIIS_C Med26 DUF4175 DUF4423 DBD_Tnp_Mut PYC_OADA Ku_C
Motif
Other DBs
NCBI-GeneID: 101158359
NCBI-ProteinID: XP_004071102
UniProt: H2MQH6
Position
7
AA seq 309 aa AA seqDB search
MAKNQEVERIAKKLDKMVQKENTEGALDLLKELQNIKMSLETLQSTRVGMSVNAVRKQSS
DEEVQTLAKSLIKSWKRLLDGSEGKSEKKEKKKEGSPLRSSSTSSDSGSSGKSAKSGDTP
TTPNTPSTPTLPPLITSFPPAPVTSDSVRNKCRELLVAALQTDDDYKTIGVDCDHLAAQI
EHQIFQEFKSTDMKYKARLRSRISNLKDQKNPDLRRNVLCGNISAQRIACMTAEEMASAE
LKQIREALTKESIREHQLSKVGGTETDMFICSKCHGKNCTYTQVQTRSADEPMTTFVLCN
GCGNRWKFC
NT seq 930 nt NT seq  +upstreamnt  +downstreamnt
atggcaaagaaccaggaagtggagcgcatcgccaaaaagctggacaaaatggtccagaag
gagaacacggaaggtgctcttgatttactgaaggaactgcagaacatcaaaatgtccctc
gagacactgcagtcgaccagagttgggatgtcggtgaacgcagtgaggaagcagagctct
gatgaagaggtgcagactctggccaaatctctgatcaaatcctggaaaagactgctggat
ggttcagaagggaaatcggagaagaaggagaagaagaaggagggctctcctttaaggtca
tcgtcaacctcgagcgactctggcagcagtgggaaaagcgcgaaatctggagacactccc
acaacgccgaacactccctctacccctaccctgcccccgctgatcacctcctttcccccc
gctcctgtcaccagtgacagtgtgaggaacaagtgtcgagagctgctggtggctgctttg
cagactgacgatgactacaagaccatcggagtggactgtgatcacctcgccgcacagatt
gagcatcagatcttccaggagttcaaatccacagatatgaaatataaagctcgtctccga
agccgcatctccaacctgaaagatcagaagaatccggacctgcggcggaacgtcctgtgt
ggaaacatctcagctcagcgcatcgcctgcatgactgctgaggagatggcgagcgcagag
ctgaagcagatcagagaagcgctgaccaaagaatccatcagagagcatcagctgtccaag
gtgggagggacggagacggacatgttcatctgcagcaagtgtcacgggaagaactgcacg
tacacgcaggtgcagacccgcagcgccgacgagcccatgaccacgttcgttttgtgtaac
ggctgcggcaaccgatggaagttctgttaa

DBGET integrated database retrieval system