KEGG   Oryzias latipes (Japanese medaka): 101158463Help
Entry
101158463         CDS       T02443                                 

Gene name
nsun2
Definition
(RefSeq) tRNA (cytosine(34)-C(5))-methyltransferase
  KO
K15335  tRNA (cytosine34-C5)-methyltransferase [EC:2.1.1.203]
Organism
ola  Oryzias latipes (Japanese medaka)
Brite
KEGG Orthology (KO) [BR:ola00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:ola03016]
    101158463 (nsun2)
Enzymes [BR:ola01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.203  tRNA (cytosine34-C5)-methyltransferase
     101158463 (nsun2)
Transfer RNA biogenesis [BR:ola03016]
 Eukaryotic type
  tRNA modification factors
   Methyltransferases
    101158463 (nsun2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Methyltr_RsmB-F FtsJ
Motif
Other DBs
NCBI-GeneID: 101158463
NCBI-ProteinID: XP_004074486
Position
11
AA seq 764 aa AA seqDB search
MGRRSRQRQRNPNPNPGRENAGWGAGYADIVKENKLFEQYYKEQGLVPEGEFEQFMEAMR
EPLPATIRITGYKSHAKEILHCLKDKYFKDLQELDIDGQKIEAPRPLSWYPDELAWHTNM
SRKIIRKSPLLEKFHQFLVSETESGNISRQEAVSMIPPLLLKIQPHHKILDMCAAPGSKT
AQLIEMLHADMDVPFPEGFVIANDVDNKRCYLLVHQAKRLNSPCIMVVNHDASCIPALQV
DSDSKKDVLLYDRVLCDVPCSGDGTMRKNIDVWKKWTTSNSLHLHGLQLRIAVRGVEQLA
VGGRMVYSTCSLNPIEDEAVIAALLEKSEGALELDDASADLPGLKYMPGVASWKLMTKEG
QWYSDWSEVPKSRHTQIRPSMFPPKGPEKVASMHLERCMRILPHHQNTGGFFVAVLVKKA
PMPWNKRHPKLRKDFSSSSAAMTGGSPVTPSPEDTPQLLSEEADGGVPVETVDGAAQQEA
LHGAPKEAGAGGDGACGPPPSKKLKLFGYKEDPFVFLTEDDPVFSAIQSFYDLSPDFPKL
NVLTRTHEGKKRHLYMVSKELRNVLLNNSERIKVINTGVKVWSRNSDGEEFGCAFRLAQE
GIYTLQPYVCSRIIRVVMNDIKVLLTQENPFLSKLEEDAHAQAKQMGMGSVVLKFIPNSD
NPTEPQCPIQLCGWRGKTSIRAFVPRNERLHYLRMLGVEVFRDKQGLGQKKEEGGPQEWK
GVEGEKEKEDDDAAEVEKEVEPGDGSEDGSSGAKNGSSSRRNVS
NT seq 2295 nt NT seq  +upstreamnt  +downstreamnt
atggggagaaggagcagacagaggcagaggaaccccaaccccaaccctggcagggaaaac
gcgggatggggagctggctacgctgacattgtgaaagagaacaagctgttcgaacagtac
tataaggaacaagggctggtccctgaaggagagtttgagcagttcatggaggccatgagg
gaaccgctgccagccaccatacggatcactgggtataagagtcatgctaaggagatcctt
cactgtttgaaggataaatacttcaaggatctccaggagctggacattgatggccagaag
attgaagctcctcggcctctcagctggtatcctgatgagctagcctggcacaccaacatg
agcaggaagatcatcaggaagtctcctctgctggagaagtttcatcagtttcttgttagc
gagacagagtctggaaacatcagtcgtcaggaggcggtcagcatgatcccccctctgctc
ctgaagatccagccccatcacaagattctggacatgtgtgcagctccgggctcaaagacg
gcccagctgattgagatgcttcacgctgacatggatgtaccatttccagagggctttgta
atcgccaatgacgtggacaacaagcgctgctacctgctggtgcaccaggccaagcgcctg
aacagcccctgcatcatggtggtcaaccacgatgcctcctgcatccctgctcttcaggtt
gactcagactccaagaaggacgtcctcctctacgaccgtgtcctgtgtgacgtcccctgc
agtggtgatgggaccatgaggaagaacatagatgtgtggaagaaatggacaaccagcaac
agcctgcacctgcatgggctccagctgcggatcgctgtgcgaggtgtggagcaactggca
gttggaggccggatggtgtactctacatgctctctgaaccccattgaggatgaagccgtc
attgctgctctgctggagaaaagtgaaggtgcgttggagctggacgatgcctctgcagac
ctgccaggactgaagtacatgccgggagtcgcttcttggaagctcatgaccaaggagggt
cagtggtatagcgactggtccgaggttcccaaaagtcgtcacacacagatccggcccagc
atgtttccccccaaaggtccagagaaagtggccagcatgcacctggagagatgtatgagg
attcttccacatcatcagaacactggaggtttcttcgtggcggttctggtgaagaaagct
ccgatgccctggaacaaaagacaccccaagctcaggaaagacttctcatccagctcagca
gccatgactgggggttctccagtcactccctccccagaagacactccccaactcctttca
gaggaggcagacggaggcgtcccagtggagacagtagatggggcagcacagcaggaggcg
cttcatggtgcaccgaaggaggctggtgctgggggagacggggcgtgtggacccccaccc
tctaaaaagctgaaactgtttggttataaagaagacccctttgtgttcctgactgaagat
gaccctgtcttcagcgccatccaatctttttatgatctgtctcctgactttccaaagctc
aatgttctgacaaggacccacgagggcaagaagagacacctgtacatggtgtctaaggag
ctccgcaacgttctgctcaacaacagtgagcgcataaaggtcatcaacactggagtgaag
gtgtggtctcgtaacagcgatggggaggagtttggctgcgccttcagactggctcaggag
ggcatctacactcttcaaccgtacgtttgctccaggatcatccgagtcgtgatgaatgac
atcaaagtgctcctgacccaggaaaaccccttcctcagcaaactggaggaggatgctcat
gctcaggccaagcagatgggaatgggaagcgtagtcctgaagttcatcccaaactcagat
aaccccacagagcctcagtgtcccatccagctgtgcggctggaggggaaagacgtcgatc
cgagcctttgtccctcgcaatgagcggcttcactacctccggatgttaggagtggaggtc
ttcagggacaagcaaggcctggggcagaaaaaggaggaagggggaccgcaagaatggaag
ggagtagagggggagaaggagaaagaggatgatgatgcagcagaggtggaaaaagaggtg
gagccaggggacggcagtgaagacggatcttcaggagcaaagaatggtagcagttcaagg
aggaacgtcagctaa

DBGET integrated database retrieval system