KEGG   Oryzias latipes (Japanese medaka): 101159021
Entry
101159021         CDS       T02443                                 

Definition
(RefSeq) endoplasmic reticulum aminopeptidase 1
  KO
K09604  adipocyte-derived leucine aminopeptidase [EC:3.4.11.-]
Organism
ola  Oryzias latipes (Japanese medaka)
Brite
KEGG Orthology (KO) [BR:ola00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:ola01002]
    101159021
Enzymes [BR:ola01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.11  Aminopeptidases
    3.4.11.-  
     101159021
Peptidases and inhibitors [BR:ola01002]
 Metallo peptidases
  Family M1
   101159021
SSDB
Motif
Pfam: Peptidase_M1 ERAP1_C Peptidase_M1_N
Other DBs
NCBI-GeneID: 101159021
NCBI-ProteinID: XP_023814008
Position
9
AA seq 938 aa
MFPLLLLLFALLPSSHGAQIPSPDQPKEIPVATNGQLFPWDRMRLPKTISPLHYDLSLHP
NLTTLDFTGVVRIDLDVHEDTSVVVLHAKKMYISSALLLAPAGTRVLQVLEYPRFHQLAL
MSDVVLTKGRKYEVQLEFAANLSDSYHGFYKSSYRTSTGEVRVMASTQFEATFARGAFPC
FDEPAFKANFTIRIIREPRHIAISNMPKVRTVELPGDLLEDHFDTTVRMSTYLVAYIVSD
FQSVSRTTQHGVKISIYAVPEKINQTAFALDAAVKLLDFYDDYFDIPYPLPKQDLAAIPD
FQSGAMENWGLTTYRETGLLFDPDRSSASDKLGITKVIAHELAHQWFGNLVTMEWWNDLW
LNEGFAKFMEFVSLDITYPELQVDDFFLGKCFEAMEVDSLSSSHPVSTPVENPTQIQEMF
DDVSYDKGACILNMLRDFLTPEAFEIGIIRYLKRFSYQNTVNSHLWESLTDICSSDDLDE
GRMKHKEFCSKRKDESGASKWYSGDELDVRAIMDTWTLQEGFPLVTVEVKGREVRLSQER
FLRTDNPSLTEGFLWQIPLTYMTSASRSVHRFLLKTKSDVLYLPEEVDWVKFNVNMSGYY
MVHYGGGGWNSIISLLHHNHTALSGNDRASLIHNVFQLVSVEKVRLDTALELSLYLSRET
EIMAVWQGFGELVPLYKLMEKRDMPELENQMKSFIVDLFRGLIDQQEWNDSGSVSQRVLR
SYLLLFACVRNYSPCVTKATRLFNQWRDSDGTMSLPVDITMAVFMVGARTREGWDFLYEK
YRTSLQMSVKSRLKWAMAVTTMTDKLQWMMEQSLNGEVMKTQDLPDVIISVARNPHGFKL
AWDFLRTHWHTLIQKFDLGSSTISHLVAGVTNQYSTREMLHEIRSFFDSLTEEAGSQMRC
IQQSYETIEDNIRWMDRNLPLLQAWLNKHGSRNHHQEL
NT seq 2817 nt   +upstreamnt  +downstreamnt
atgtttcctctcctgctcctactctttgctctgctcccttcatctcatggagctcaaata
ccaagtccagaccaacccaaggagatcccagtagccacaaatggccagctgtttccctgg
gaccgcatgagactccccaaaaccatctccccactccactatgacctgagcctccacccc
aacctcaccaccctggacttcaccggcgtcgttcgcatagacctggacgtgcacgaagac
accagcgttgtggttctccatgcaaagaaaatgtacatatcaagcgcgctgttgctcgcg
ccagcgggcacgagggtcctccaggttctggagtatcctcgctttcatcagctcgccttg
atgtctgacgtggtgctgaccaaaggcaggaagtatgaggtccagctggagtttgctgca
aacctgtctgacagctaccatgggttctacaagagcagctaccgcaccagcaccggggag
gtccgggtcatggcatcaacacagtttgaggcgacctttgctcgtggggcctttccctgt
tttgatgagcccgccttcaaagccaacttcaccatccggattattagagagccacgccac
attgccatttccaacatgcccaaggtgaggacagtggagttaccaggcgatctactggag
gatcactttgacacgacggtgaggatgagcacctacctggtggcctacatcgtgtctgac
ttccagtcggtgagcaggaccacccagcacggagtgaagatttccatctacgctgttcca
gagaagatcaaccagacagcctttgcactggatgctgctgttaagctgctggacttctat
gatgactacttcgacattccttacccacttcccaaacaggacttggccgccatccctgac
ttccagtctggagccatggagaactgggggctgaccacctatcgagagaccggcctcctc
ttcgatccggacaggtcctccgcctccgacaaactgggcatcaccaaggtgatcgctcat
gagctggctcaccagtggtttggaaacctggtgacgatggagtggtggaatgacctgtgg
ctcaacgagggctttgccaagtttatggagtttgtctccctggacatcacctacccagaa
ctgcaagtggatgacttcttcttgggaaaatgtttcgaagctatggaggtggactcgctc
agctcctcccacccagtctccacccccgtggaaaaccccacacagatccaggagatgttc
gacgatgtgtcctatgacaagggagcctgcattctgaacatgctgcgtgactttctcact
cctgaggcctttgagatcggcatcatccgatacctgaagcgcttcagctatcagaacact
gtcaacagccacctctgggagagcctgactgacatctgcagctcagatgatttggacgaa
ggccgaatgaagcacaaagagttttgctccaaacgcaaagacgagtctggagcctctaag
tggtactcgggtgatgagctggatgtcagggccatcatggacacctggacgctgcaggag
ggcttcccgctggtcaccgtggaggtcaaagggcgggaggtcaggctgagtcaggagcgc
ttccttaggacggacaacccctccctcactgaagggttcttgtggcagatcccgttgacg
tacatgaccagcgcctcccgctccgtccaccgtttccttctgaaaacaaaatctgacgtc
ctgtacctgccagaggaggtggactgggtgaagttcaacgtcaacatgagcggctactac
atggtccactatggcggtgggggctggaactccatcatctccctgctgcatcacaaccac
acagccctgagtggcaacgaccgggccagcctgatccacaacgtcttccagctggtcagt
gtagagaaggtgaggctggacacggccctggagctgtccctttacctgtccagagagacg
gagatcatggcggtctggcagggctttggggaacttgtacctctctacaaactgatggag
aagcgagacatgcctgagctggagaaccagatgaagagcttcatcgtggatctgtttcgg
gggctgatcgatcagcaggagtggaacgactctggctcggtgtcccagcgagtgttgagg
agttacctgctgctgttcgcctgcgtcaggaattacagtccctgtgtgaccaaagccacg
cggctttttaaccagtggagggattctgatggcaccatgagcctccctgtggacatcacc
atggccgtgtttatggttggagctcgcacacgggaggggtgggacttcctgtatgagaag
taccgcacgtctctgcagatgtcggtgaagagccgcttgaagtgggccatggcggtaaca
acgatgacggacaagcttcagtggatgatggagcagagcctcaacggggaggtgatgaag
acccaggacctcccagatgtgatcatctctgtcgccaggaatcctcatggctttaaactg
gcgtgggacttcctcagaacccactggcacacgctgattcagaagtttgacctgggatcc
agcactatatcccacttggtagccggagtaaccaaccagtactccaccagagagatgctt
cacgagatacgaagcttcttcgactccctgacagaagaggcgggttctcagatgaggtgc
atccagcagagctacgagaccatcgaggacaacatccgctggatggacaggaaccttcct
ctgctgcaggcctggctgaacaaacatggcagcagaaaccaccatcaggagttatga

DBGET integrated database retrieval system