KEGG   Oryzias latipes (Japanese medaka): 101159055Help
Entry
101159055         CDS       T02443                                 

Gene name
abhd12b
Definition
(RefSeq) protein ABHD12B isoform X1
  KO
K13704  abhydrolase domain-containing protein 12 [EC:3.1.1.23]
Organism
ola  Oryzias latipes (Japanese medaka)
Brite
KEGG Orthology (KO) [BR:ola00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:ola01002]
    101159055 (abhd12b)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ola04147]
    101159055 (abhd12b)
Enzymes [BR:ola01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.23  acylglycerol lipase
     101159055 (abhd12b)
Peptidases [BR:ola01002]
 Serine Peptidases
  Family S9: prolyl oligopeptidase family
   101159055 (abhd12b)
Exosome [BR:ola04147]
 Exosomal proteins
  Exosomal proteins of other cancer cells
   101159055 (abhd12b)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hydrolase_4 Abhydrolase_1 Abhydrolase_6 LIP Thioesterase Abhydrolase_2
Motif
Other DBs
NCBI-GeneID: 101159055
NCBI-ProteinID: XP_004082118
Position
22
AA seq 334 aa AA seqDB search
MRRTLTLLISVYASVPVFLYLFPWLLSHAVFAHLLRVPFFVDLSRPQDVLNHTCNFYLNT
EEDVWVGVWHTLPASQWEAASGRSADWYQEALGDGQPVIIYLHGNVGTRALRHRVELVTL
LSAAGFHVLSLDYRGFGDSSGHPSEAGLTSDALYLQQWAKTRSGGSPVCLWGHSLGSGVA
TNAAVRLQEGGGALLPSGCHEAAVDALILEAPYTRIGDVAANLLLTKIYTFLPGLKDFLF
DLLEKNQIEFANDKNLKTLTCPLLILHAEDDNVVPHRMGQQLYQVSLEAQREFGTDDRVA
MVSYPADLGFSHSNIYMDPSLPEIVKKFLQNSRR
NT seq 1005 nt NT seq  +upstreamnt  +downstreamnt
atgaggagaaccttgacgctcctgatcagcgtctatgcttcagtccctgttttcctctac
ctgtttccatggttactgagtcacgccgtgttcgctcacctgttgagggttccattcttc
gtggacctcagccgacctcaggatgtgctgaaccacacctgcaacttctacctcaacacg
gaggaggacgtctgggtgggagtgtggcacacactccccgccagccaatgggaggcggcc
tctgggagaagcgccgactggtatcaggaggctctgggagacggccagcctgttatcatt
tatctccatggcaacgtagggaccagagcgctgaggcacagagtggaactggtgacgctc
ctgagcgctgctggcttccatgttttatctttggactacagaggtttcggagattcctct
ggacatcccagcgaggcagggctgacctctgacgccctctacctgcagcagtgggcgaag
acgcgcagcgggggcagccccgtgtgcctgtggggtcactctctgggttcgggggtggcc
accaacgctgcagtcagactacaggaaggaggtggggccctcctcccctcaggttgtcat
gaggcagcagtggatgctttgatacttgaagctccgtacacaagaattggagacgttgca
gcaaacctgctgctcactaagatctacacgttccttccaggattgaaggacttcctcttt
gaccttctggaaaagaaccagattgaatttgccaacgataaaaacttgaagacgctcacc
tgcccgctcctcatcctgcacgccgaggacgacaacgtggttcctcatcgcatgggccag
cagctctaccaggtctccctggaggcgcagcgagagttcggcacagacgatcgggtcgcc
atggtctcctatcctgctgatctgggattttctcacagcaacatctacatggaccccagt
ttaccagaaatagtcaagaaatttttgcaaaactcaagacggtga

DBGET integrated database retrieval system