KEGG   Oryzias latipes (Japanese medaka): 101159364Help
Entry
101159364         CDS       T02443                                 

Gene name
ppt2
Definition
(RefSeq) lysosomal thioesterase PPT2
  KO
K01074  palmitoyl-protein thioesterase [EC:3.1.2.22]
Organism
ola  Oryzias latipes (Japanese medaka)
Pathway
ola00062  Fatty acid elongation
ola01100  Metabolic pathways
ola01212  Fatty acid metabolism
ola04142  Lysosome
Brite
KEGG Orthology (KO) [BR:ola00001]
 Metabolism
  Lipid metabolism
   00062 Fatty acid elongation
    101159364 (ppt2)
 Cellular Processes
  Transport and catabolism
   04142 Lysosome
    101159364 (ppt2)
Enzymes [BR:ola01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.22  palmitoyl[protein] hydrolase
     101159364 (ppt2)
Lipid biosynthesis proteins [BR:ola01004]
 Fatty acid synthase
  Component type
   101159364 (ppt2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Palm_thioest DUF676 Lipase_2 PGAP1 PPO1_DWL
Motif
Other DBs
NCBI-GeneID: 101159364
NCBI-ProteinID: XP_004073825
Position
11
AA seq 305 aa AA seqDB search
MKDRNIPPRGGRWKRSSGVLAGLFMPLLCACFWAGGSAYKPVIIVHGLFDSPKNLLNLQR
FISESHPGTNVTIIDLFDGYESLKPLWTQVEGFKAVIYPIMQNAADGVHFICYSQGGLVC
RGILSTLPEHNVHTFISLSSPQAGQYGDTDYFKDVFPECVKSEIYHFCYLGIGQRFSICN
YWKDPHHKDLYVNVSSYLALLNTEKPHPNATEWRKNFLKIQKLVLIGGPDDGVITPWQSS
QFGFYDDNETVVEMQKQDFYLSDAFGLKTLAAREDLITCTFPGVQHIQWHSNETVFHACM
EKWLV
NT seq 918 nt NT seq  +upstreamnt  +downstreamnt
atgaaagacagaaacattcctcctcggggaggaagatggaagcggagcagcggcgtcctg
gcagggctcttcatgcccctcctgtgtgcgtgtttctgggctggggggtccgcatacaag
ccggtgattatagtccacggtttgttcgacagccccaaaaatttactcaacttgcagcga
ttcatcagcgagtctcatccagggacaaacgtgaccatcatcgatctgtttgacggctat
gaaagcttgaaaccactctggactcaggtggagggattcaaggcggtcatttacccaata
atgcaaaatgcagcagacggcgtccactttatctgctactctcaaggcgggttggtttgc
agagggatcctctccaccctccctgaacacaacgtccacaccttcatctctctgtcctcg
cctcaggccggccagtatggagacaccgactactttaaggatgtcttcccagaatgtgta
aaatcagaaatctaccatttttgctaccttgggattggtcagaggttttccatctgcaac
tactggaaagacccccaccacaaagacctgtatgtgaacgttagcagttatttagctttg
ctcaacacggagaagccacatcccaatgcaacagaatggaggaagaacttcctgaaaatc
caaaagctggtgctgattggaggaccggatgacggcgtcatcacgccctggcagtcgagt
cagtttgggttttatgacgacaacgagaccgtcgttgagatgcagaaacaagacttttac
ctgagcgacgctttcgggctgaagacgctggcggctcgggaagatctgatcacctgcact
tttcccggagtccagcacatccagtggcactccaacgagacggtgttccacgcctgcatg
gagaagtggctggtttaa

DBGET integrated database retrieval system