KEGG   Oryzias latipes (Japanese medaka): 101159506Help
Entry
101159506         CDS       T02443                                 

Definition
(RefSeq) voltage-dependent calcium channel gamma-5 subunit
  KO
K04870  voltage-dependent calcium channel gamma-5
Organism
ola  Oryzias latipes (Japanese medaka)
Pathway
ola04010  MAPK signaling pathway
ola04260  Cardiac muscle contraction
ola04261  Adrenergic signaling in cardiomyocytes
Brite
KEGG Orthology (KO) [BR:ola00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101159506
 09150 Organismal Systems
  09153 Circulatory system
   04260 Cardiac muscle contraction
    101159506
   04261 Adrenergic signaling in cardiomyocytes
    101159506
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:ola04040]
    101159506
Ion channels [BR:ola04040]
 Voltage-gated cation channels
  Calcium channel, voltage-gated (Cav)
   101159506
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PMP22_Claudin Claudin_2 DUF716 FtsX DUF5453 Claudin_3 DUF4199 DHHC
Motif
Other DBs
NCBI-GeneID: 101159506
NCBI-ProteinID: XP_023813336
Position
8
AA seq 276 aa AA seqDB search
MSACSRKALTLLSSVFAISGLGLLGVAVSTDYWLYLEEGVIMPLNQSTDIKTSLHSGLWR
VCFLAGEESGRCFTIEYVMPMSVQLTSESTVNVLKMIRSATPFPVVSLFFMFIGFVLNNI
GHIRPHRSLLAFVSGIFFILSGLALVVGLVLYISSINDEMLNRTKSSEAHFSYKYGWSFA
FAALSFLLTESAGVMSVYLFMKRYTAAEIYQPRHPNFYRPRLSNCSDHSGQFLHPEAWSR
GRSPSDISSDTSLQMSASYPALLKCPDYDQVSSSPC
NT seq 831 nt NT seq  +upstreamnt  +downstreamnt
atgagtgcgtgcagcaggaaggctttgactttactcagcagcgtatttgcaatcagtggc
ctggggctgctgggagtggcagtgagtacagattactggctgtatctggaggagggcgtc
atcatgcctttgaaccagagcacggacatcaagacgtcactgcactccggcctctggagg
gtctgctttttggctggtgaggagtcgggccgctgcttcactatcgagtatgtcatgccg
atgagcgtccagctgacgtcagaatccacagtgaatgtgctcaaaatgatccggtcagcg
actcccttcccagtggtcagcctctttttcatgttcatcggttttgtcctcaacaacatt
ggtcacatacgtcctcatcgcagcctcctggcattcgtgtctggaatcttcttcatcctt
tcaggccttgctttagtggtgggcctggtgttgtacatttcaagcataaacgatgaaatg
ctgaaccgcactaagagcagtgaggctcatttttcctataagtatggttggtcttttgcc
ttcgctgccctctcttttctgctcactgagagtgcaggcgtcatgtccgtctacctgttc
atgaagcgctacacagcagctgagatctaccaaccacgccaccccaacttctaccgccct
cgcctcagcaactgctctgaccactctggtcagttccttcacccagaggcctggtcgcgt
gggcggagcccctcagacatctccagtgacacctcccttcagatgagtgccagctaccct
gccctccttaaatgtcctgactatgatcaggtgtcatcttcaccttgctga

DBGET integrated database retrieval system