KEGG   Oryzias latipes (Japanese medaka): 101159946Help
Entry
101159946         CDS       T02443                                 

Definition
(RefSeq) UDP-glucuronosyltransferase 2C1
  KO
K00699  glucuronosyltransferase [EC:2.4.1.17]
Organism
ola  Oryzias latipes (Japanese medaka)
Pathway
ola00040  Pentose and glucuronate interconversions
ola00053  Ascorbate and aldarate metabolism
ola00140  Steroid hormone biosynthesis
ola00830  Retinol metabolism
ola00860  Porphyrin and chlorophyll metabolism
ola00980  Metabolism of xenobiotics by cytochrome P450
ola00982  Drug metabolism - cytochrome P450
ola00983  Drug metabolism - other enzymes
ola01100  Metabolic pathways
Module
ola_M00014  Glucuronate pathway (uronate pathway)
Brite
KEGG Orthology (KO) [BR:ola00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    101159946
   00053 Ascorbate and aldarate metabolism
    101159946
  Lipid metabolism
   00140 Steroid hormone biosynthesis
    101159946
  Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    101159946
   00860 Porphyrin and chlorophyll metabolism
    101159946
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    101159946
   00982 Drug metabolism - cytochrome P450
    101159946
   00983 Drug metabolism - other enzymes
    101159946
Enzymes [BR:ola01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.17  glucuronosyltransferase
     101159946
Glycosyltransferases [BR:ola01003]
 Others
  Hydrophobic molecule
   101159946
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: UDPGT Glyco_tran_28_C Glyco_trans_1_3 Alpha_E3_glycop
Motif
Other DBs
NCBI-GeneID: 101159946
NCBI-ProteinID: XP_020567177
Position
18
AA seq 530 aa AA seqDB search
MSPAVSGLLTVLGFLLLLLGGSPCSSSKILVVPVDGSHWVNMKVILEELHSRGHELTVLR
SAKSWYISSNSSFYTSINVPMLEDEADREFYHKMIQDVLDCRRHPSFIRTFCQQEVMTFA
FSNGHRILARAATTIIEDQALMKKIRDTEFDLMLTDPALPLGVVLGGYLKLPMVFNVRWI
NLGEGHLTIAPSPLSYVPISGTELHDKMDFLDRVKNMLHYLHTVVEQHFIVNPAYSDLFR
RYFPPGTDLLSLQYSAEIWLLRADFVFEFPRPTMPNVVYIGGFQCKEAQPLPDEFETFVQ
SSGEHGVVVMSLGTLVSALPRETTEAIAAVFAQLPQKVIWRFVGEKPSSLGNNTRIVNWL
PQNDLLGHPKTRAFVAHGGTNGVYEAIYHGVPVLGLPLLFDQFDNLLRLEVRGAARVVEV
RSLNKENFHEALNDILNNPTYRNNIQRLSQLHRDRLISPLETAIFWIEYVIRNRGAAHLQ
SRGFDLPWYSYFCLDVAAFFVTISGAFIWVSVSVCRFLCCRKSRRKTKAE
NT seq 1593 nt NT seq  +upstreamnt  +downstreamnt
atgtcccccgccgtctctgggttgctgacagtcctgggctttctgctgcttctgctcgga
ggatccccttgcagcagcagcaagattcttgtcgttcctgttgatggcagccattgggtc
aacatgaaggtgatcctggaagagcttcactccagaggccacgagctcacagtcttgcgc
tccgctaagagttggtacatctccagcaactcctctttttacacctccatcaatgtgcct
atgctggaggatgaggcagacagagagttctaccataaaatgatccaggacgtcttggat
tgtcgcagacacccaagttttatacggacattttgccaacaggaagtgatgacatttgca
ttttcaaacggccacaggattctggcaagagctgccacaactattatagaagatcaagct
ctcatgaaaaagatcagagatacagagtttgacctgatgttaacagaccctgctctgcct
ttaggagttgttctgggaggttacttgaagttaccaatggtgtttaacgtgcgatggatt
aacttgggggagggccatttgaccatagccccctctcctctatcctatgttccgatctca
ggaactgagctacatgataaaatggattttctagatagggtcaagaatatgttgcactac
ctccatactgtagttgagcaacattttatcgttaaccccgcttattcagatctttttagg
cgctacttcccacctggaacagacttgctgtctctacagtattcagcagaaatctggttg
ctgcgggcagactttgtctttgagttccctagacccaccatgcccaatgtggtgtacatt
gggggcttccagtgcaaggaagcccaaccactccctgatgagtttgaaacattcgtccaa
agttctggggaacacggggtggtggtcatgtctttgggaacactggtatcagcgcttccc
cgtgaaaccaccgaggccattgctgctgtttttgctcagctccctcagaaggtgatttgg
cgttttgttggggaaaagccttcttcactcggaaataacactcgtattgtcaactggtta
ccccagaatgatctcttgggtcaccctaagactcgtgcctttgttgctcatggaggaacc
aatggtgtgtatgaggccatttatcacggtgttcctgttctgggtctaccgctcctcttt
gatcagtttgataaccttctccggttggaggtgcgcggtgcagctcgtgttgtggaagtc
agatcactgaacaaggaaaacttccatgaagctctaaatgatatcctcaacaatcctacc
taccgcaataatattcagcgcctctctcaactccatcgtgaccggctaatatcccctttg
gaaacagccatcttctggatcgagtacgtcatcagaaacagaggggcggctcacctacaa
tcaagaggctttgacctgccttggtactcctacttctgcctggacgtggctgctttcttt
gtgactataagtggagccttcatctgggtctcagtctcagtttgtaggtttctctgctgc
aggaagtccaggagaaagacgaaagcagagtaa

DBGET integrated database retrieval system