KEGG   Oryzias latipes (Japanese medaka): 101162018Help
Entry
101162018         CDS       T02443                                 

Definition
(RefSeq) guanine nucleotide-binding protein subunit alpha-13
  KO
K04639  guanine nucleotide-binding protein subunit alpha-13
Organism
ola  Oryzias latipes (Japanese medaka)
Pathway
ola04270  Vascular smooth muscle contraction
ola04371  Apelin signaling pathway
ola04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:ola00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    101162018
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    101162018
 09150 Organismal Systems
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    101162018
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ola04147]
    101162018
   04031 GTP-binding proteins [BR:ola04031]
    101162018
Exosome [BR:ola04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   101162018
  Exosomal proteins of colorectal cancer cells
   101162018
GTP-binding proteins [BR:ola04031]
 Heterotrimeric G-proteins
  Alpha Subunits
   Alpha type 4 (G12/13)
    101162018
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: G-alpha Arf Gtr1_RagA Roc FtsK_SpoIIIE
Motif
Other DBs
NCBI-GeneID: 101162018
NCBI-ProteinID: XP_004084309
Position
19
AA seq 377 aa AA seqDB search
MADFLPTRSVLKVCLPVCLLNSGEVEQIQKSKKIDKNLSREKKYVKRLVKILLLGAGESG
KSTFLKQMRIIHGDDFDQRARQEFKPTIYSNVIKGIRVLVDAREKLHIPWGDPKNSTHGD
KVMAINTRSAMMANGQLETADFVEYLPAIRALWADSGIQNAYDRRREFQLGEAVKYFLDN
LDKLSEPDYLPSQQDILLARKPTKGIHEYDFVIKNVPFKMVDVGGQRSERRRWFECFDSV
TSILFLVSSSEYDQVLMEDRQTNRLCESLNIFETIVNNRVFANVSIILFLNKTDLLEEKV
KTVKLKDYFPEYTGPEHSLPDIQGFMVDCFRAKRRDGPQKLLYHHFTTAINTENIRLVFR
DVKDTILHDNLKQLMLQ
NT seq 1134 nt NT seq  +upstreamnt  +downstreamnt
atggcggatttcctgccgaccaggtctgtgttaaaagtttgcctacccgtctgcttgctt
aatagcggcgaggtagagcaaatacaaaagtctaagaagatcgacaaaaatctctcccgg
gagaaaaagtacgtcaaacggctggtaaagatcctgctgctcggcgctggcgagagcggc
aagtcgactttcctcaaacaaatgcgaatcatccacggcgatgacttcgaccagcgagcg
cgacaggagttcaaaccaacgatttacagcaatgttatcaaaggcattcgtgtgctggtg
gacgcccgggagaagctgcacatcccatggggggacccaaagaacagcacgcacggggac
aaagtgatggcaatcaacacccggtcggccatgatggccaacggccagctggaaacggcc
gactttgtggagtacctgcccgccatcagggccctgtgggcagactccggcatacaaaac
gcctacgaccgccgcagagagtttcagctgggggaggcggtgaagtatttcttggataat
ctggataagctgagcgagccggattatcttcccagtcagcaggacatcctgctggcccgt
aaacccaccaaaggcattcacgagtacgactttgtgatcaagaacgttcccttcaagatg
gtggacgtgggggggcagcggtccgagcgcaggcgctggttcgagtgtttcgactcggtc
acctccatcctcttccttgtatcttcctctgaatatgatcaggtcctgatggaggacagg
cagaccaaccggctctgtgaatcactgaacatctttgagaccatcgtcaacaaccgcgtc
ttcgccaacgtctccatcatcctcttcctcaacaagacagacctgctagaagagaaggtg
aaaaccgttaagcttaaggactatttccccgaatacaccggaccggagcacagcctgcca
gacatccagggcttcatggtagactgcttccgcgccaaacggcgcgacggcccccagaag
ctgttgtaccaccacttcaccacggccatcaacactgagaacatccggctggtgttccgg
gacgtcaaagacaccatcctccacgacaacctgaagcagctcatgctccaatga

DBGET integrated database retrieval system