KEGG   Oryzias latipes (Japanese medaka): 101162762
Entry
101162762         CDS       T02443                                 

Definition
(RefSeq) deoxycytidine kinase
  KO
K00893  deoxycitidine kinase [EC:2.7.1.74]
Organism
ola  Oryzias latipes (Japanese medaka)
Pathway
ola00230  Purine metabolism
ola00240  Pyrimidine metabolism
ola01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ola00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    101162762
   00240 Pyrimidine metabolism
    101162762
Enzymes [BR:ola01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.74  deoxycytidine kinase
     101162762
SSDB
Motif
Pfam: dNK AAA_18 AAA_33 Thymidylate_kin CoaE
Other DBs
NCBI-GeneID: 101162762
NCBI-ProteinID: XP_004072416
Position
9
AA seq 324 aa
MSALCRPILVSLLSGTRPGLLLVRTSEFKQRNEPLSSMSGGNSVAPPAQRTNTMMPTLNV
TGSSDSHPRFLSSSSPKSEFRVKRVSIEGNIAVGKSTFAKLLQTACSDWEVVAEPVSKWQ
NIKSGSSKETHGSPQTTVSNLLQMMYKEPQRWSYTFQTFSCMSRFRTQLQPPPAHLLNSE
GTPVQVYERSIYSDRYIFALNMFELGCINDTEWAVYQDWHSLLVERFGHQVELEGIIYLR
ASPEKCMERLKFRGRSEEKEVELDYLEKLHIQHEKWLVEKSAEIHFEKLKNVPVLQLDGS
AEFLTDPEVRKQFISQVKNFFNAL
NT seq 975 nt   +upstreamnt  +downstreamnt
atgtctgcactgtgccgacccattctagtcagccttctctccggaactcgaccagggttg
ctcctggttagaacatctgaattcaaacagagaaacgagcctttgagctccatgagcggc
ggaaactcagtcgctcctccggctcagaggacaaatacaatgatgccaacgcttaatgtc
acaggtagttctgactctcatcctcggttcttgtcatcctcaagtccgaagtcagaattt
cgagtcaagagagtttctattgaaggcaacatagctgttggaaagtcaacctttgccaaa
cttctccagactgcttgttcagactgggaagttgtggcagaaccagttagcaagtggcaa
aatattaaaagtgggtcttcaaaggaaacacatgggagtccacagacaacagttagcaac
ctgctgcagatgatgtacaaggaacctcagcgctggtcatacacctttcagacattttcc
tgcatgagtcggtttaggacgcagctgcagcctcctcctgctcacctgctcaactcagag
gggacacctgtccaggtgtatgagcgctccatttacagtgacagatacatctttgcttta
aacatgtttgagctgggttgcatcaacgatactgagtgggctgtctatcaggactggcac
tctcttctggtggagcgatttggacaccaggtggagctggagggcatcatttacctaagg
gcctctcctgagaaatgtatggagcgtttgaagttccggggaagatcagaggagaaggaa
gtggagctggactacctggagaagctgcacattcagcatgagaagtggcttgtagagaaa
agcgccgagatacactttgaaaaattaaaaaacgttcctgtccttcaacttgacggcagt
gcagagttcttgactgatccagaagttaggaagcagtttatttcacaggtgaagaacttc
ttcaatgctttataa

DBGET integrated database retrieval system