KEGG   Oryzias latipes (Japanese medaka): 101162861
Entry
101162861         CDS       T02443                                 

Gene name
tm7sf2
Definition
(RefSeq) delta(14)-sterol reductase
  KO
K00222  Delta14-sterol reductase [EC:1.3.1.70]
Organism
ola  Oryzias latipes (Japanese medaka)
Pathway
ola00100  Steroid biosynthesis
ola01100  Metabolic pathways
Module
ola_M00101  Cholesterol biosynthesis, squalene 2,3-epoxide => cholesterol
Brite
KEGG Orthology (KO) [BR:ola00001]
 09100 Metabolism
  09103 Lipid metabolism
   00100 Steroid biosynthesis
    101162861 (tm7sf2)
Enzymes [BR:ola01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.70  Delta14-sterol reductase
     101162861 (tm7sf2)
SSDB
Motif
Pfam: ERG4_ERG24 DUF1295 ICMT PEMT DUF4006
Other DBs
NCBI-GeneID: 101162861
NCBI-ProteinID: XP_004076636
UniProt: A0A3B3HDU7
Position
14
AA seq 425 aa
MGLDGKAPNHRLRHDTQKEFGGTLGAVCIPIFLPLTVLFLIGLSRSPEASVLQWPPSLPS
YNQLLDPLAPVLLLGWIALHILLYHLPLGKVSEGLVLRDGTRLKYPINGIHGLCVSVALL
SLLMWLGAPLGYLFELLLPLAASAIAVSFLLSIYLYIRSFWAPSHALALGGNTGNPLYDF
FIGRELNPRIGNFDLKYFCELRPGLIGWVVINFGMLMKEVELRGSPSLAMILVNSFQLLY
VADALWNEEAVLTTMDIVHDGFGFMLVFGDLAWVPFTYGLQAAFLVVHPQTLTWLKAVFI
LLLNGMGYYIFRKSNSQKNQFRRDPTHPSVTGLETIATATGKRLLVSGWWGFVRHPNYLG
DLLMALAWSLPCGFSHLLPYFYVIYFTVLLVHREARDERQCKAKYGLAWDAYCRRVPYRI
FPFIY
NT seq 1278 nt   +upstreamnt  +downstreamnt
atgggattagatggcaaagcaccaaatcacagattaagacatgacacacagaaggagttt
ggaggaactctaggtgccgtgtgcattcccatatttctaccactgactgtactattcctg
attggcctgagtcgaagtccagaagcgagtgtgctccagtggcctccttcccttccctcc
tacaatcagctgttggaccctctggctcctgtgcttctgctggggtggatcgctctgcac
atcctcctctaccatctcccattagggaaggtgtctgaagggttggttctcagggatgga
acacgactcaagtatcccattaatggtatccacggcctttgtgtcagcgtcgcgctcctg
agtttgttaatgtggctgggtgctcccctcgggtatctgtttgagctgctcctgcctctg
gcagcgtctgccatagcggtgtccttcctcctctccatctacctctacatccgctcattt
tgggctccctcccatgctctggctttgggcggaaacacaggaaatcctctgtatgacttc
tttattggacgggagctgaacccccgcattggaaacttcgacctgaaatacttctgtgag
ctcaggccaggtttgattggctgggtggtgataaattttggaatgctgatgaaggaggtg
gagctccgagggtccccctcccttgccatgatcctggtgaacagcttccagctgctgtat
gtggcagatgctctgtggaatgaggaagcagtcttaacgaccatggacatcgtgcacgac
ggttttgggttcatgctggtcttcggggacctggcctgggtcccgttcacgtacggcctg
caggctgccttcctggttgtgcacccacagaccctgacctggctcaaggctgtatttata
ctcttgctgaacggtatgggatattacattttcagaaaatccaactcgcagaagaaccag
ttcaggcgagacccgactcatccaagtgttactggtctggaaacaattgccacggcaaca
gggaagcgtctgctagtgtctggctggtggggtttcgtacgtcatcccaactacttgggg
gacctcctcatggctctggcctggtccctgccctgtgggttttcacatctcctgccttat
ttctacgtcatctacttcaccgtcctgctggttcacagagaggcgcgcgatgagaggcag
tgcaaagccaaatatggactggcgtgggacgcctactgccgtcgcgtcccctataggatc
tttcctttcatctactga

DBGET integrated database retrieval system