KEGG   Oryzias latipes (Japanese medaka): 101163005Help
Entry
101163005         CDS       T02443                                 

Gene name
plcg1
Definition
(RefSeq) 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase gamma-1
  KO
K01116  phosphatidylinositol phospholipase C, gamma-1 [EC:3.1.4.11]
Organism
ola  Oryzias latipes (Japanese medaka)
Pathway
ola00562  Inositol phosphate metabolism
ola01100  Metabolic pathways
ola04012  ErbB signaling pathway
ola04020  Calcium signaling pathway
ola04070  Phosphatidylinositol signaling system
ola04370  VEGF signaling pathway
ola04933  AGE-RAGE signaling pathway in diabetic complications
Module
ola_M00130  Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Brite
KEGG Orthology (KO) [BR:ola00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    101163005 (plcg1)
 Environmental Information Processing
  Signal transduction
   04012 ErbB signaling pathway
    101163005 (plcg1)
   04370 VEGF signaling pathway
    101163005 (plcg1)
   04020 Calcium signaling pathway
    101163005 (plcg1)
   04070 Phosphatidylinositol signaling system
    101163005 (plcg1)
 Human Diseases
  Endocrine and metabolic diseases
   04933 AGE-RAGE signaling pathway in diabetic complications
    101163005 (plcg1)
Enzymes [BR:ola01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     101163005 (plcg1)
Membrane trafficking [BR:ola04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Phospholipases
    101163005 (plcg1)
 Endocytosis
  Macropinocytosis
   Phospholipase C
    101163005 (plcg1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PI-PLC-X SH2 PI-PLC-Y PH C2 SH3_1 SH3_9 SH3_2 PH_12 GDPD
Motif
Other DBs
NCBI-GeneID: 101163005
NCBI-ProteinID: XP_011475498
Position
7
AA seq 1311 aa AA seqDB search
MAGTSGFFSNGPVPWMDNDTEMNNLYRDLELGTVLTLFYSKKSQRPERRTFLVKLETRTI
IWTRSTDKIEGEIDIREIKEIRSGQKSRDFERYTEDPSVRLDQAHCFVILYGTEFRLKSL
SLAATSDEEMTMWVKGLNWLLADTLKSSTPLQIERWLRKQFYAVDRNREDRISCKDLKNM
LSQVNYRVPNMRFLREKFPDLELRNGDVSFSQFEQLYRNLMFDAQKNMEIPLLQSFTERP
DRRILLEDFKSFLIESQNELWATDNNKVQEFMFDYLKQPLREVEQPYFQQDEFLTYLFSK
ENSIWDSSLDLVCPENMNNPLSHYWISSSHNTYLTGDQFSSESSLEAYARCLRMGCRCIE
LDCWDGPDTMPVIYHGHTLTTKIKFIDVLTTIKEHAFVTSEYPIILSIEDHCNIVQQRNM
ASQFKKVFGDMLLTKAVDMAADNLPSPNQLKRKIIIKHKKLAEGSAYEEVSTSTPYSEND
ISNSIKNGLLYLEDPVNHEWYPHFFVLTNSKIYYSEETSSNQGNDEEEEHREVASSMDQH
VTEKWFHGKLGAGRDGRQIAERLLTEYCLETGAPDGTFLVRESETFVGDYTLSFWRSGRV
QHCRIHSRQEAGSPKFYLTDNLVFDTLFALISHYQQVPLRCNEFEMKLTEPVPQTNAHEN
KEWYHANLSRSHAENMLMRVPRDGAFLIRKRAEPNSYAISFRAEGKIKHCRVQQEGQTVQ
LGTSEFDSLVDLVSYFEKHPLYRKMKLRYPINEDTLEKIGTAEPDYGSLYEGRNPGFYVE
ANQMPTLKCTVRAMYEYKAQRDDELSFTKDTIISNVDKQEGGWWKGDYGGKKQFWFPANY
VEEISPSAAEPDITDMTENSPLGDLLRGSVDLSSCQIVPRPEGKGNRPYVFSLVLNTNMR
TILDVSATNQEELKEWMNKIREVTMTSEAKLEEGKMMERRKKIALELSDLVIYCRPVPFD
EEKIGTERACFRDMSSFPETKAEKYANKIKGKKFLQYNRLQLSRIYPKGQRLDSSNYDPL
PMWLCGSQLVALNFQTADKPMQMNQALFMLNGRNGYVLQPPIMRDDSFDPFDRNTLRGIE
QVTLAIEVLGARHLPKNGRGIVSPLVEIEVCGAEYDNSKQKTESTVDNGLNPMWPKKSFH
FTVYNSAFAFLRFLVNEVDMFNDQNFLAQATFPIQGLKTGYRSVPLKNSYNEDLELASLL
VHLDVIRGRNENGDIPSSFLVGSTPVTASAHGGRERFGELSSVSSTSSSMSSLPQSPAQA
MAYRGREGSFESRYQSPLEDFRVSQEALFDHMDPQNRRMLLRTKVSGENRV
NT seq 3936 nt NT seq  +upstreamnt  +downstreamnt
atggctgggacctctggcttcttttccaatggacctgttccgtggatggacaacgacaca
gagatgaacaacctttacagagacttggagcttggcactgtactgacattgttttattcc
aagaaatctcagcgacctgaaagacgaacttttctagtaaaactggagaccaggactata
atctggacacggagcacagataaaatcgaaggagaaattgacatccgggagatcaaggag
atccgttcgggtcagaagtcccgggacttcgagcgctacacagaagacccgtcagtacgg
ctggaccaagctcactgctttgtcattctgtatggcacagagtttcgcctcaagtccctc
agcctcgcagcaacatcggatgaggagatgaccatgtgggtgaaggggttaaactggctt
ttggctgacacactgaagtcctcaacaccacttcaaatagaaaggtggttacgcaaacag
ttctatgcagttgatcgcaacagggaagacaggatatcctgtaaagatctgaagaacatg
ctgagccaggtcaactacagagtgcccaacatgaggttcctccgggagaaatttccggac
ttggagttgaggaacggagacgtgtccttcagccagtttgagcagctgtaccgtaatctg
atgtttgatgctcagaaaaatatggagattccacttctgcaaagcttcactgaaagacct
gacaggaggattttactagaggacttcaagagcttcttgattgagtcccaaaatgaactc
tgggccacagacaacaacaaggttcaggagtttatgtttgactatctgaaacagccccta
agagaagtggagcagccttattttcaacaagatgagttcctcacataccttttctccaaa
gagaattccatttgggattcctccctagacctagtctgtccagagaacatgaacaatcct
ttgtcccactactggatctcctcttcgcacaacacctacctgacgggagaccagttttct
agtgagtcatcgttggaagcttatgctcgctgtctgagaatgggctgtcgctgtattgag
ttggactgctgggatggtccagacacaatgccagtcatctaccacggacacaccctcaca
acaaaaataaaatttattgatgtcctgacgacaatcaaagaacacgcctttgtcacgtca
gagtatcccatcatcctctccattgaggaccactgtaatattgtgcagcagagaaacatg
gcatctcagttcaagaaggtgtttggagacatgctgctgaccaaggcggtggacatggca
gcagataacctgccctcacccaaccagctcaagagaaagatcatcatcaagcataagaag
cttgctgaaggcagtgcttatgaggaggtgtccacctccaccccctactcggagaatgat
atcagcaactctattaaaaacggcctcctgtacctggaggatcctgttaaccatgagtgg
tatcctcatttctttgtcctgaccaacagtaagatctactactcagaagagacctccagt
aaccagggcaacgatgaagaagaggaacacagagaggtggcttctagtatggaccagcac
gtgacagagaagtggttccatggaaagcttggcgctggacgcgatgggcggcagatagca
gagaggctgctgactgaatactgccttgagactggagctcctgacggtacttttctggtg
cgggagagtgaaacttttgttggagactacactctctctttctggcgctcggggagggtg
cagcactgtcgtatccactcgcgccaggaggcgggcagccccaagttctacctgaccgac
aacctcgtgtttgacacgctctttgctctgatcagtcactaccagcaggtgccactacgc
tgcaatgaatttgagatgaaactgacagaaccagtgcctcagaccaatgcacatgagaac
aaagagtggtaccatgctaacttatccaggagccatgcagaaaacatgctgatgagggtt
cctcgtgatggagctttcctcatcaggaaaagagcagaaccaaactcttatgccatctcc
ttcagggctgagggtaagatcaaacactgtcgagttcagcaggagggccagaccgtgcag
ttgggcacctccgagtttgacagcctagtagatctcgtcagttattttgaaaagcaccct
ctgtatcgcaaaatgaagctgcgctatcccatcaacgaggacactctggaaaaaataggc
actgctgagccagactatggttctctgtatgagggaaggaatcctggcttttatgtggag
gctaatcaaatgccaactttgaagtgcacagtgagagcgatgtacgagtataaagcccag
cgagacgacgaactctccttcaccaaggacaccatcatttctaatgttgacaaacaggaa
ggtggctggtggaaaggtgattatggaggaaagaagcagttctggtttcctgcaaactat
gtggaggaaatcagtccatcagcagcagagcctgacataactgacatgacagaaaacagt
cctctgggagatctgttgagaggaagcgtggatttgtcttcctgtcagattgttccgcgc
cccgaggggaagggcaacaggccgtacgtcttttctctggttctgaataccaacatgcgc
acaatcctggacgtgtctgccaccaatcaggaggagcttaaggaatggatgaacaagatt
cgtgaagttaccatgacctcggaggccaagctggaggaagggaagatgatggagaggagg
aagaagattgctctagagttgtcagacctggtcatctactgtcggcctgtgccgtttgat
gaagagaagattggtacagagagagcttgtttccgtgacatgtcgtccttcccggaaacc
aaagcagagaaatatgccaacaagattaaagggaagaagttccttcagtacaaccgacta
caactgtccaggatctatccaaaggggcagcgactagactcctctaattatgaccctcta
cccatgtggctctgtggttctcagctggttgcacttaattttcagacagcagataagccc
atgcagatgaaccaggcactgttcatgctaaatggaaggaatggttacgttcttcagcct
cccatcatgagggacgacagctttgatccttttgacagaaacacgctaagaggcatcgaa
caagtcactctagcgatagaggtcttgggcgcccggcacttgccaaagaatggacgaggc
attgtttcccctctggttgagattgaggtgtgtggagcagagtacgacaactccaagcaa
aaaactgagtcaacagttgataatgggctgaaccccatgtggccaaagaagtcattccac
ttcacagtgtacaactctgcttttgccttcctgcgttttctggttaatgaggtcgacatg
ttcaatgaccagaacttcctggctcaagctacattccccatccagggcctcaagacaggc
taccggtcagtgcctttgaagaacagctacaatgaggatctggagttggcttctctgttg
gtccacctggatgtcatcagaggcaggaatgaaaatggcgacattccaagctcgttcctg
gttgggagcacaccagtcacagcatcagcccacggagggcgggaacgttttggggagctg
agctccgtgtcctccacgtcctccagcatgtcttctctgccccagtcgccagctcaggcc
atggcttaccgggggcgggagggctcttttgagtcccgctaccagtccccgctagaggac
ttcagggtgtctcaggaggctctgtttgaccacatggacccacagaatagaaggatgctg
ctgcggaccaaagtgagcggagaaaaccgtgtctga

DBGET integrated database retrieval system