KEGG   Oryzias latipes (Japanese medaka): 101163987Help
Entry
101163987         CDS       T02443                                 

Definition
(RefSeq) bone morphogenetic protein receptor type-1B
  KO
K13578  bone morphogenetic protein receptor type-1B [EC:2.7.11.30]
Organism
ola  Oryzias latipes (Japanese medaka)
Pathway
ola04060  Cytokine-cytokine receptor interaction
ola04350  TGF-beta signaling pathway
Brite
KEGG Orthology (KO) [BR:ola00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    101163987
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    101163987
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ola01001]
    101163987
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:ola04090]
    101163987
Enzymes [BR:ola01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.30  receptor protein serine/threonine kinase
     101163987
Protein kinases [BR:ola01001]
 Receptor serine/threonine kinases (RSTK): TKL group
  TGFBR1 family [OT]
   101163987
CD molecules [BR:ola04090]
 Proteins
  101163987
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr Pkinase TGF_beta_GS Activin_recp FTA2 Haspin_kinase Kinase-like APH
Motif
Other DBs
NCBI-GeneID: 101163987
NCBI-ProteinID: XP_004074823
UniProt: H2LUN9
Position
12
AA seq 530 aa AA seqDB search
MLLLTRLAVLLVTGLASLSCSSDANMLETMLLKSGWKDGSERRAEESSTATASVQNTLRC
HCYPQCPEGSVNNTCMTNGFCFTMVTEEEVGQVVLTAGCLSLAGSEFQCRDSWSARLWRK
LECCTNQDYCNRDLHPTLPPLVTSEFMNSSIQYIALFTSVTLCSILLVIIALCYFRYKRQ
ASQPRYSADLDQDEIYIPPGDSLKDLMEHTRSIGSGSGSGLPLLVQRTIARQIQMVKQIG
KGRYGEVWMGKWREEKVAVKVFFTTEEESWFRETEIYQTFLMRHDNILGFIAADIKGTGS
WTQLYLITDYHENGSLYDYLKSNTLDVMALLKLAFSSISGLCHLHTEIYGTQGKPAIAHR
DLKSKNILVKKNGSCCIADLGLAVKYKSDTDEVDIPLNLRVGTKRYMPPEVLDETLNRTT
FQSFIMADMYSFGLILWEMARRCISGGIVEDYQLPYYDLVPTDPSYEDMREVVCIKKQRP
LFVNHWSNECLRQMGKLMSECWAHNPACRLTALRVRKTVAKMLESQDIKL
NT seq 1593 nt NT seq  +upstreamnt  +downstreamnt
atgttgctgttgacccggcttgcagttctcctggttaccgggcttgcatcgctgagctgt
agttctgatgccaacatgttggagaccatgctcctgaagagcggatggaaggatggatca
gagcgaagggcggaggagagcagcacagccaccgcctcggttcagaacacgctgcggtgc
cactgctacccgcagtgccccgaaggctctgtcaacaacacttgcatgactaacggcttc
tgcttcaccatggttacggaggaggaggtgggtcaagtcgtgctgacagcaggttgttta
tcgctggccggctccgagttccagtgcagagattcatggagtgcgcgcttgtggagaaag
ctggaatgctgcacgaatcaggactactgcaaccgagacctccacccaacgctccccccg
cttgtgacatcagagttcatgaacagcagtatccagtacattgcgctcttcacttccgtt
acactctgcagcatcctcttagtcattattgccttgtgctacttcagatataagcgtcag
gcatcacaaccacgctacagtgcagatcttgaccaggatgagatttacatcccgccagga
gattctctgaaggacctgatggagcatacccgcagcattgggtcaggatctgggtcagga
ctccctctgctggttcagcgcaccattgccaggcagattcagatggttaaacagatcggg
aaagggcgatatggagaagtctggatgggaaaatggagggaagagaaagtagctgtgaaa
gtcttcttcaccactgaggaggaaagctggttcagagagacagagatctatcaaaccttc
ctgatgaggcatgacaacatactggggttcatagcagccgatattaaaggaacaggctcg
tggactcagctgtacctcattacagactaccatgagaatggatccttgtatgactacctt
aagtctaacaccttagatgtcatggctttgctcaagctggccttctcctctatctcaggc
ctctgtcacttacacacagagatctacggcactcagggcaagcctgccatcgcacaccga
gacctgaagagcaaaaacattctggtcaagaagaacggctcctgctgcatcgcagacttg
gggctcgctgttaagtacaaaagtgacacagatgaggtcgacatccctcttaacttgaga
gtgggaacaaagcgctacatgccacctgaagtgttagacgagaccttgaacaggactacg
ttccagtcttttataatggctgacatgtacagctttggtcttatcctttgggagatggcc
cggcgttgcatctctgggggcattgtggaggattatcagctgccctattatgacctcgtg
cccaccgacccgtcctatgaggacatgagagaagttgtttgcataaagaagcagagacct
ttatttgttaatcattggagcaatgagtgtctaagacagatggggaagctgatgtcagag
tgttgggctcacaacccagcctgtcgcctaacagccttgcgggtgaggaagactgtggcg
aagatgttagaatcccaagacatcaaactgtga

DBGET integrated database retrieval system