KEGG   Oryzias latipes (Japanese medaka): 101164048Help
Entry
101164048         CDS       T02443                                 

Gene name
gpx7
Definition
(RefSeq) glutathione peroxidase 7
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
ola  Oryzias latipes (Japanese medaka)
Pathway
ola00480  Glutathione metabolism
ola00590  Arachidonic acid metabolism
ola01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ola00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    101164048 (gpx7)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    101164048 (gpx7)
Enzymes [BR:ola01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     101164048 (gpx7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GSHPx AhpC-TSA Redoxin PepSY
Motif
Other DBs
NCBI-GeneID: 101164048
NCBI-ProteinID: XP_004068182
UniProt: A0A3B3IKS1
Position
4
AA seq 185 aa AA seqDB search
MLRSALAVFVTLFSLSESKQKDFYTFKVVNSRGKLVSLEKYRGSVSLVVNVASECGFTEE
HYKDLQQLQRDFGSSHFNVLGFPCNQFGQQEPGSDKEIDSFVRRVYGVSFPLFSKIAVVG
TGAHNVYKYLADSSGKEPDWNFWKYLIDVNGKVVDAWGPKVSVKEIRPKIAEMVRQIILK
KKEEL
NT seq 558 nt NT seq  +upstreamnt  +downstreamnt
atgctccgctcagcgctcgccgtttttgtaacactattcagtctctctgaaagcaaacaa
aaggacttttacaccttcaaagttgtgaacagcagagggaagctcgtgtctctagaaaaa
taccggggttcggtgtcgctggtggtgaacgtagccagtgaatgtggcttcaccgaagaa
cattacaaagacctgcagcagctccagcgggactttggctcaagtcacttcaatgttctg
ggtttcccctgcaaccagttcgggcagcaggagccgggcagcgacaaggaaatcgacagc
tttgtgcgcagagtctatggagtctccttcccgctgttcagcaaaatcgctgtagttgga
acaggagcccataatgtctacaagtatcttgctgactcgtccggaaaagagcccgactgg
aacttctggaagtatctcattgacgtgaacggcaaagtggtggatgcgtggggacccaag
gtttccgtcaaagaaatccggcccaaaatagctgaaatggttcggcagataatcctaaag
aagaaagaggagctttaa

DBGET integrated database retrieval system