KEGG   Oryzias latipes (Japanese medaka): 101165670Help
Entry
101165670         CDS       T02443                                 

Gene name
parp2
Definition
(RefSeq) poly [ADP-ribose] polymerase 2
  KO
K10798  poly [ADP-ribose] polymerase [EC:2.4.2.30]
Organism
ola  Oryzias latipes (Japanese medaka)
Pathway
ola03410  Base excision repair
ola04210  Apoptosis
ola04217  Necroptosis
Brite
KEGG Orthology (KO) [BR:ola00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03410 Base excision repair
    101165670 (parp2)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    101165670 (parp2)
   04217 Necroptosis
    101165670 (parp2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:ola03032]
    101165670 (parp2)
   03036 Chromosome and associated proteins [BR:ola03036]
    101165670 (parp2)
   03400 DNA repair and recombination proteins [BR:ola03400]
    101165670 (parp2)
Enzymes [BR:ola01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.30  NAD+ ADP-ribosyltransferase
     101165670 (parp2)
DNA replication proteins [BR:ola03032]
 Eukaryotic type
  DNA Replication Termination Factors
   Other telomere regulation proteins
    Others
     101165670 (parp2)
Chromosome and associated proteins [BR:ola03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Centriole proteins
    101165670 (parp2)
DNA repair and recombination proteins [BR:ola03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Other BER factors
     101165670 (parp2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PARP PARP_reg WGR WWE Asp1
Motif
Other DBs
NCBI-GeneID: 101165670
NCBI-ProteinID: XP_011484327
UniProt: A0A3B3IL62
Position
17
AA seq 638 aa AA seqDB search
MRRTRGSMNKNQSLPKNEDMESITEWQWQGDGGRWESYPPAACALLDSALSAGTPAVTLN
AGSGTAYEVDLKNMVQINPVTKYRRKIRSQTVKPDSLNEAEPQPVQVKEEEEETEEQPVT
KKRRGRSKSQAKSQEGNSEVVKTVVMKGRAPVDPECNAKLGKAHVYSEGSIVYDVMLNQT
NLQFNNNKFYLIQLLQDDSSKSFSVWMRWGRVGKVGQNSLTACGGDLLKAKDIFKKKFFD
KTRNEWEQRGSFVKVAGKYDMVFMDYSTNEKEENTTVVDAATNKRSCKLDPKVQSLLELI
CDLKAMEECVLEMKFDTRKAPLGKLTSEQIRAGYAALKKIEECLKRKGSSRDLLEACNQF
YTRIPHDFGLRPPPVIHTDAELKEKISLLEALSDIQIAVKMVQSSADSEEHPLDRHYHSL
KCNLQPLDSTSSEFKVIEKYLQSTHAPTHRDYGMTVLDIFSVDRDGESESFLSDLHNRTL
LWHGSRLSNWVGILSKGLRVAPPEAPVTGYMFGKGIYFADMSSKSANYCFANQSNHVGLL
LLCEVALGDCNELLDADYEANNLPAGKHSTKGLGQTAPDPKNSVTLDGVTVPMGPGVKTG
AANSSGYSLLYNEFIVYSPAQTRMRYLLRIQFNYSSLW
NT seq 1917 nt NT seq  +upstreamnt  +downstreamnt
atgaggcgaactaggggttcaatgaataaaaaccaaagtttgccaaaaaacgaagacatg
gagtcaataacagaatggcagtggcagggggacggaggccggtgggagtcatacccgccg
gcggcgtgtgccctgctggattcggctctgtctgcgggaacaccggccgtcactctgaac
gcgggttccggcaccgcatacgaggtggatctgaagaacatggtccagatcaatcctgtc
acaaagtaccgaaggaaaattcgcagtcagactgtgaaaccagacagtttaaatgaagct
gaaccacaacctgtccaggttaaagaggaagaggaggagacagaggagcaacctgtgacg
aagaaaagaagaggacgaagcaagagtcaggcaaaaagccaagaaggaaacagtgaagtt
gtgaagacggtggtgatgaagggcagagctccagtggaccctgaatgcaacgccaaactc
ggaaaggctcatgtttacagtgaaggaagcatcgtctatgatgtgatgctgaaccagaca
aaccttcagttcaacaacaataagttctacctgatccagcttctgcaggacgacagctcc
aagtccttcagcgtgtggatgcgatggggcagagtgggcaaagtgggccagaacagcctc
acggcgtgtggtggagatctgctgaaggccaaggacatcttcaagaagaagttctttgat
aaaaccaggaatgagtgggaacagcgggggagttttgtgaaagtggctgggaagtatgac
atggtgtttatggactacagcaccaatgagaaggaggagaacaccacagtggtggatgct
gctaccaacaagaggagctgcaagttggatccaaaggttcagtctctcctggagctgatc
tgtgacctcaaagccatggaggagtgtgtgctggagatgaagttcgacacacggaaagct
cctcttggcaagctgacttcggaacagatccgtgcgggctatgcagcgctgaagaagatc
gaggagtgcttaaagaggaagggcagcagtcgggacctgctggaagcatgcaaccagttt
tacacacgcatcccacatgactttggattgagacctcctccggtcatccatacagatgct
gagctgaaggagaagatttccctgctggaggcgctgagtgacatccagatcgcagtgaag
atggtccagtccagcgcagacagtgaggagcatcctctggaccgacattaccactctctg
aagtgtaacctgcagccgctggactccaccagctctgagttcaaggtgatagagaagtac
ctgcagtccactcatgcccccacccaccgggactacggcatgacggtgctggacatcttc
tcagtggacagagacggggagagtgagagcttcctctcagatctgcacaacaggactctg
ctgtggcacggctcccggctctcaaactgggtgggcatcctcagcaagggcctccgagtg
gccccgcctgaggcccctgtcacagggtatatgtttggtaaaggaatctactttgctgac
atgtcatcaaaaagtgccaactactgcttcgccaaccagagcaaccatgtgggcctgctg
cttctatgtgaggttgctctgggagactgcaacgagctgctggatgcagactatgaagcc
aataatctccctgcaggaaaacacagcaccaagggcctgggacagacggcgcctgacccc
aaaaactctgtcactctggatggcgtgacggtgccgatgggtccaggagtgaaaacggga
gcggctaacagcagcggttactccctcctctacaacgagttcatcgtttacagtccagct
cagactcgcatgaggtacctgctgcgcatccagttcaactattcgtctctgtggtga

DBGET integrated database retrieval system