KEGG   Oryzias latipes (Japanese medaka): 101165809Help
Entry
101165809         CDS       T02443                                 

Definition
(RefSeq) histone acetyltransferase KAT7 isoform X1
  KO
K11307  histone acetyltransferase MYST2 [EC:2.3.1.48]
Organism
ola  Oryzias latipes (Japanese medaka)
Brite
Enzymes [BR:ola01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     101165809
Chromosome and associated proteins [BR:ola03036]
 Eukaryotic Type
  Histone modification proteins
   HATs (histone acetyltransferases)
    101165809
   HAT complexes
    HBO1 complex
     101165809
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MOZ_SAS zf-C2HC Acetyltransf_7 zf-met
Motif
Other DBs
NCBI-GeneID: 101165809
NCBI-ProteinID: XP_023813543
Position
8
AA seq 645 aa AA seqDB search
MPRRKVGQHHVIANVSRAERTAGSSSDGTEDSDFSADLEHADASDNGRRRSSARLTRSSL
RLSQSSQENCRPARRLSSAAAARDDGPDVSADSAAPASVFSSGRRITRSQQGASSTTAKK
YPLRQSRSSGSDTEANDGKHGADRDETPPRTPTGNASSSESDLEVSSSNNETVTSNDIIV
SQEEDERLAKELSLKEAAAHDLSHRPKRRRFHESYNFNMKCPTPGCNSLGHLTGRHERHF
SISGCPLYHNLSADECKGKASTRDKLAEERTLSHRHDENRHSTRNQAPSDRQLRYKEKVT
DLRRKRDSGLNKEQKDKYMEHRQSHGTSREPLLENITSDYDLELFRKAQARASDDLEKLR
LAGQVSEGSNMIKTIVFGRYELDTWYHSPYPEEYARLGRLYMCEFCLKYMKSQTILRRHM
AKCVWKHPPGDEIYRKTNISVFEVDGKKNKIYCQNLCLLAKLFLDHKTLYYDVEPFLFYV
MAEADNTGCHLVGYFSKEKNSFLNYNVSCILTMPQYMRQGYGKMLIDFSYLLSKVEEKVG
SPERPLSDLGLISYRSYWKDVLLRYMNNFQGKEISIKEISQETAVNPVDIVSTLQALQML
KYWKGKHLVLKRQDLIDDWKAKETKRGNGKTIDPTALKWTPPKGT
NT seq 1938 nt NT seq  +upstreamnt  +downstreamnt
atgccgcggagaaaggtgggacagcatcacgtcatagctaatgttagccgcgcagagaga
acggccgggagcagctcagacgggaccgaggattccgatttttccgccgaccttgagcac
gccgatgcttccgataacggccggaggcggagcagcgctcgcctgacccgctcctccctg
cgcctcagccagagctcacaagaaaactgtagaccagctcgccgcctgtcctctgctgcg
gcggctcgagacgacggcccagacgtgtccgcagactcagcagcaccggcctccgtcttc
tcctccggccgcaggatcacgcgcagccagcagggggcgagcagcaccacggccaaaaag
tacccgctgcgacaaagccgctcatcaggctcggatactgaagctaacgacgggaagcac
ggggcggaccgggacgagactcctccccggaccccgacaggcaacgcctcttcttcagag
tcggacctcgaggtctccagctcaaacaacgagacggtgacgtccaacgacatcatcgtt
tctcaggaggaggacgagaggctggccaaagagctgtcgctgaaggaggcggctgcccac
gacctctcccaccgccccaaacgacgccgattccacgaaagttacaacttcaacatgaag
tgtcccacacctggatgcaactcactgggacatctgacaggaagacacgagagacacttc
tccatttctggatgcccgctctaccacaacctctctgcagacgaatgcaagggcaaagca
tcaacgcgcgacaagctggctgaggagaggacgctgtcgcaccggcacgacgagaacaga
cactccaccagaaaccaggcgccgagcgatcgtcagctgcgctacaaggagaaggtgacg
gacctgaggaggaagagggactccggcctgaataaagagcagaaggacaagtacatggag
caccggcaaagccacgggacgagccgggagcccctgttggagaacatcaccagcgactac
gacctggagctgttcaggaaagcgcaggcacgtgcctcggacgaccttgagaagctccgt
ctggcgggtcaggtgtcggagggcagcaacatgatcaaaaccatcgtgttcggccgctac
gagctggacacctggtaccactccccgtacccggaggagtacgcccgcctggggaggctg
tacatgtgcgagttctgcctcaagtacatgaagagtcagaccatcctgcgcagacacatg
gccaaatgtgtgtggaagcatccgccaggagatgagatctacaggaagaccaacatctct
gtcttcgaagtggatggaaagaagaacaagatctactgtcagaatctgtgcctgctggcc
aaactctttctggaccacaagactctgtactacgacgtcgaacccttcctcttttacgtc
atggccgaagccgacaacacgggctgtcacttggttggctacttctctaaggagaagaac
tccttcctgaactacaacgtgtcctgcattctcaccatgcctcagtacatgcggcagggt
tacggcaagatgctcatcgacttcagttacctgttatccaaggtggaggagaaggtgggc
tctccagagcgccccctgtcggacctgggcctgatcagctacaggagttactggaaagac
gttctgctgcgctacatgaacaactttcagggcaaggagatctccattaaagagatcagc
caggagacggcggtgaacccggtggacatcgtcagcacgctgcaggcgctccagatgctg
aaatactggaaggggaagcacctggtcctgaaacgacaggacctaatcgatgactggaag
gcgaaggagaccaaacggggtaacggcaagaccatagaccccacagccttaaaatggacc
ccccctaaagggacataa

DBGET integrated database retrieval system