KEGG   Oryzias latipes (Japanese medaka): 101166260
Entry
101166260         CDS       T02443                                 

Gene name
ahrr
Definition
(RefSeq) aryl hydrocarbon receptor repressor
  KO
K09094  aryl hydrocarbon receptor repressor
Organism
ola  Oryzias latipes (Japanese medaka)
Brite
KEGG Orthology (KO) [BR:ola00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:ola03000]
    101166260 (ahrr)
Transcription factors [BR:ola03000]
 Eukaryotic type
  Basic helix-loop-helix (bHLH)
   Factors with PAS domain
    101166260 (ahrr)
SSDB
Motif
Pfam: PAS HLH PAS_3 PAS_9
Other DBs
NCBI-GeneID: 101166260
NCBI-ProteinID: XP_011487064
Position
20
AA seq 690 aa
MIPPGDCMYAGRKRRKPIQKQKPSSANEKTNPSKRHRDRLNAELDRLASLLPFPPDVISK
LDKLSVLRLAVSYLRVKSFFQASQEKTSRKQMIGSASSNPNPRKESVSLDATISESNLLL
ESLTGFALVVSSDGMVFYASSTIVDYLGFHQTDVMHQNVFDYIHIDDRQEFRRQLHWAMC
PPQHQGAPAQENQQASGAGEDFVVSSLFNSPEAGEIPPELSCFLNRCFLARVRCLLDSTS
GFLTMQFQGRLKFLHGQKKKTASGVLVPPQLALFCIAVPLLLPPISEMKVKNILMRGKNK
GGGVISAMDQSPHSDRGEHLRRHSLNGGMGDISDPVLLSCPNMGASQRGHHASWNAVCKD
NHKYHPDGYLNQEEPLNYCKSSMAAHKGLHAGMGGGWPLQQNSGPLRGAQGCIPTNRLNR
ASQYGRPYRYSPSCHNGRSNEVFISKLYENVQLPTDPDAFCVDLVKSEGDYAECYDQHLM
PAMQPIKVEQDSDSENGCDVYGQTWATRDQVPIDRRYGNGFYDPNSGLQLKSEADYYDQQ
YSPCQRGKVGISPPYNHSNYPNYAVNNGGGTAARLLKSDKDLSDSSHFSPQRLSHSDSLC
NNQSVNHMDPHIYPQNPNKSYMHPDYNKHGTYEFKGHGRIHSIKREPMDSPPWSDSGPDI
NHSIMVGARNVMPCVMSTGHQRSSPYMYMP
NT seq 2073 nt   +upstreamnt  +downstreamnt
atgatcccgccgggggactgcatgtatgcgggcagaaagaggaggaagcccatccagaaa
cagaagccttcctctgccaatgagaaaaccaacccatccaagcgacaccgggacaggctg
aacgctgaacttgaccgactggccagcctcctgccattcccccccgatgtcatctccaaa
ctggacaagctgtccgtgctgcgactcgcagtttcctacctccgtgtgaaaagtttcttc
caagcgagtcaagagaagacctccagaaagcagatgattggctcagcgtcctccaacccc
aaccccaggaaagagagcgtctctctagacgccaccatcagcgagagcaacctcctcttg
gagtctttgacaggctttgccttggtggtgagcagcgatggaatggttttttatgcttct
tcaactattgtggactacttaggatttcatcagactgacgtgatgcaccaaaatgtcttt
gactacatccacatagacgaccgccaggagttcaggcgccagctccactgggctatgtgt
cctccacagcaccagggggcgcctgcacaagaaaaccaacaagcatcaggagctggtgag
gactttgtagtgagcagcctgttcaactccccggaggcgggagaaatcccccccgagctc
tcctgctttctcaacagatgctttttagccagagtccgatgcctcttggacagcacctct
gggttcttgaccatgcagttccagggtcggttaaagtttctccatggtcagaaaaagaag
acagcctctggcgtgttagtgcctccccagctggctctgttctgcatcgctgtacctctt
ttgctgccccccatctctgagatgaaagtgaaaaacattttaatgcggggaaagaacaag
ggaggaggggttatctctgcaatggatcaaagtcctcacagtgaccgtggagagcacctg
cggaggcactccttaaacggagggatgggtgacatttctgaccctgttctcctctcctgt
cccaatatgggggctagccagcgaggccaccatgcttcctggaatgccgtctgcaaagac
aatcacaaataccaccctgatggctaccttaaccaggaggagcccctcaactactgcaag
tcctccatggcggctcataaaggtctccatgccggtatgggtggaggctggcccttgcag
cagaactctggtcctctaagaggggctcagggctgcatccccacgaaccgcttgaacagg
gccagtcagtatgggaggccttatcgttattctccgagctgtcacaacggtagaagcaac
gaggtcttcatctccaagctctacgagaatgtccagctcccgacagatccagacgccttc
tgcgtagacctggtgaagagcgagggcgactacgcagagtgctacgaccaacatctgatg
cctgcaatgcagcccatcaaggtggagcaggactcagactctgagaacggatgcgatgtt
tatgggcaaacctgggcaacccgcgaccaagtacccattgaccggcgctatggcaacggc
ttttatgacccaaactctggcttgcaacttaaatcagaagcagattactatgaccagcag
tattcgccgtgtcagcggggaaaagtgggaatcagccctccgtacaaccacagcaattat
ccaaactatgcagtcaacaatggcggcggcacagctgcacgcctcttaaaatctgacaaa
gacttgagtgactccagccacttcagtccccaaagactctcccactcagattctctatgc
aacaaccaatcagtcaaccacatggacccccacatctacccacaaaaccccaacaagagc
tacatgcacccagactacaacaagcacggcacctatgagttcaaaggtcatggtcggatc
cattcaatcaagcgggagcccatggactctccgccgtggtctgacagcggtcctgacata
aaccactccatcatggttggagcaaggaacgttatgccgtgtgtgatgagcacggggcac
cagcggtccagcccctacatgtacatgccatag

DBGET integrated database retrieval system