KEGG   Oryzias latipes (Japanese medaka): 101166981Help
Entry
101166981         CDS       T02443                                 

Definition
(RefSeq) erlin-1
  KO
K23341  erlin
Organism
ola  Oryzias latipes (Japanese medaka)
Brite
KEGG Orthology (KO) [BR:ola00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:ola04121]
    101166981
Ubiquitin system [BR:ola04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   ERAD complex
    101166981
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Band_7 DUF4346
Motif
Other DBs
NCBI-GeneID: 101166981
NCBI-ProteinID: XP_023819555
Position
15
AA seq 338 aa AA seqDB search
MTMPHVGAVFAAMAGVVALMLHSSIHKIEEGHLAVYYRGGALLTTPNGPGYHIMLPFITT
YRAVQTTLQTDEIKNVPCGTSGGVMIYFDRIEVVNMLVPTAVVDIVRNYTADYDKTLIFN
KIHHELNQFCSVHTLQEVYIELFDIIDENLKTALQKDLNAMAPGLTIQAVRVTKPKIPES
IRRNFELMEAEKTRLLITVQTQRVVEKEAETERKKAIIEAQKVAQVAEIHFRQKVMEKET
EKKISEIEDAAFLARERAKADAEYYTAAKFSEANRLKLTPEYLELMKYQAIAANSKIYFG
QDIPNMFVEGNSNSPKSGPTSSLPGSESDVFKAKPDGH
NT seq 1017 nt NT seq  +upstreamnt  +downstreamnt
atgacaatgccgcatgtgggggcagtatttgcagcaatggcaggagtggttgccctcatg
ctgcactcctccattcacaagatagaggaaggacaccttgccgtctactacagaggtgga
gctttactaactactcccaatggtccaggatatcatatcatgttgcctttcatcaccaca
tacagagcagtgcagaccacgcttcaaactgatgagatcaagaatgtgccttgtgggaca
agtggtggtgtgatgatctactttgacagaatagaagttgtaaatatgttggtccctaca
gcagtggtggacattgtgaggaactacacggccgattatgacaaaactctcatttttaac
aagattcaccacgaattgaaccagttttgtagcgtccacacacttcaggaagtctacatt
gagctgttcgatattatagatgaaaacctcaaaactgcactgcagaaagatctgaacgct
atggcacctggacttacaatacaggctgtccgtgtcaccaaaccgaagattcccgagtct
atcaggaggaactttgaactcatggaagcagagaaaactcgtctcctaataacggttcag
actcagagggttgtggaaaaggaggcggagactgaaaggaagaaagccattattgaggct
cagaaagtggctcaagtagcagagatccattttagacaaaaggtgatggagaaagagact
gagaagaagatttctgaaatagaagatgctgctttcctggccagggagagggccaaagca
gatgcagagtattacactgctgctaagttttctgaggcaaacaggcttaagttgacgccg
gagtacctggagctgatgaagtatcaggccatagctgctaacagtaagatctactttggt
caggacattccgaacatgtttgttgaggggaacagcaattcgcccaagtctggaccaact
tcaagtttgcccggctctgaatcagacgtgttcaaagctaagccagatgggcactga

DBGET integrated database retrieval system