KEGG   Oryzias latipes (Japanese medaka): 101167585Help
Entry
101167585         CDS       T02443                                 

Gene name
nme6
Definition
(RefSeq) nucleoside diphosphate kinase 6
  KO
K00940  nucleoside-diphosphate kinase [EC:2.7.4.6]
Organism
ola  Oryzias latipes (Japanese medaka)
Pathway
ola00230  Purine metabolism
ola00240  Pyrimidine metabolism
ola00983  Drug metabolism - other enzymes
ola01100  Metabolic pathways
Module
ola_M00049  Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
ola_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
ola_M00052  Pyrimidine ribonucleotide biosynthesis, UMP => UDP/UTP,CDP/CTP
Brite
KEGG Orthology (KO) [BR:ola00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    101167585 (nme6)
   00240 Pyrimidine metabolism
    101167585 (nme6)
  09111 Xenobiotics biodegradation and metabolism
   00983 Drug metabolism - other enzymes
    101167585 (nme6)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ola04131]
    101167585 (nme6)
Enzymes [BR:ola01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.6  nucleoside-diphosphate kinase
     101167585 (nme6)
Membrane trafficking [BR:ola04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Kinases and associated proteins
    101167585 (nme6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: NDK
Motif
Other DBs
NCBI-GeneID: 101167585
NCBI-ProteinID: XP_004083726
UniProt: A0A3B3HU76
Position
24
AA seq 184 aa AA seqDB search
MFPTTRHLSRVLQLTLAVIKPDAVAHPLMMEALHQKILDNDFKIVRCKDLVWERQDSEKF
YAEHSGRFFYQRLVEFMSSGPMRAYVLAREDAIRHWRGLMGPTKVFRARYTDPNSIRAQF
GLTDTRNTTHGSDSPESAQREISFFFPDFHTADWMEKEEPLFRSGKMTYDHQNQVHVLSA
ATQP
NT seq 555 nt NT seq  +upstreamnt  +downstreamnt
atgttcccgacgactcgccacctgtccagagtgctgcagctcactctggcggtcattaag
cctgatgctgttgctcatccgttgatgatggaggctcttcaccagaaaattctagataac
gattttaaaattgtcagatgcaaggatctggtgtgggaacggcaggactcggagaagttt
tacgccgagcattcaggccgattcttctatcaaagacttgttgaatttatgtcgagtggt
ccgatgagagcgtatgttttagccagagaagatgcaatccgtcactggaggggactgatg
ggaccgaccaaagtgttcagagccagatacaccgacccgaattctatcagggcccagttt
gggctcacagatacaagaaacacaactcatggctcagattctccagagtcggctcaaaga
gagataagcttcttcttcccagatttccacacggcagactggatggagaaagaagagccg
ctgttcagatcaggaaagatgacctatgaccatcagaaccaggtccatgttttatcagca
gcaacacaaccttaa

DBGET integrated database retrieval system