KEGG   Oryzias latipes (Japanese medaka): 101167863Help
Entry
101167863         CDS       T02443                                 

Gene name
cpt2
Definition
(RefSeq) carnitine O-palmitoyltransferase 2, mitochondrial
  KO
K08766  carnitine O-palmitoyltransferase 2 [EC:2.3.1.21]
Organism
ola  Oryzias latipes (Japanese medaka)
Pathway
ola00071  Fatty acid degradation
ola01212  Fatty acid metabolism
ola03320  PPAR signaling pathway
Brite
KEGG Orthology (KO) [BR:ola00001]
 09100 Metabolism
  09103 Lipid metabolism
   00071 Fatty acid degradation
    101167863 (cpt2)
 09150 Organismal Systems
  09152 Endocrine system
   03320 PPAR signaling pathway
    101167863 (cpt2)
Enzymes [BR:ola01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.21  carnitine O-palmitoyltransferase
     101167863 (cpt2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Carn_acyltransf Sds3
Motif
Other DBs
NCBI-GeneID: 101167863
NCBI-ProteinID: XP_004068195
UniProt: H2MEX2
Position
4
AA seq 666 aa AA seqDB search
MAALVWVQRTASLRNPGSLLHSRSPVLRLRCRFHVGRKSCSSEFLHRSVVPSMHYQKSLP
RLPIPKLEDSISRYLAAQMPLLDDDQFRTTEKVAQDFLKGEGRQLHEELVLMDKNNKHTS
YISAPWFDMYLSARDSLVLNFNPFMSFNPDPKQEYNDPLVRSTNMVCSAVRFMKTLRAGL
LEPEVFHLNPAKSDTATFKKFIRWVPSSLSWYGAYMVNAYPLDMSQYFRLFNSTRIPKQG
RDELFNDEKGRHLLVLRRGNMYVFDVVDGDGNMVKPVEVQAHLKYIMSDPKPEAEFPLGV
LTSENRDVWAGLREKLIAAGNAEDLGTVDSALFCLCLDDETMKDHIHISHNMLHGDGCNR
WYDKSFSIIMAKDGQAAINFEHAWGDGVAVLRFQNEVFKDTTERPLVHPGSTPAADSASA
VRQLDFKLTSELKNDIKKAKQNFDSAVSKLTIDAMEFKKGGKEQLKKNKLSPDAVAQLAF
QMGFLRQYGQTVATYESCSTAAFKHGRTETIRPATVHTKRCSQAFVHQPGAHSVEQLRGM
LHECSKYHGQLTKEAAMGQGFDRHLFALRYLATSQGRPLHTLYTDPAYAAINHNILSTST
LTSPAVSLGGFAPVVPDGFGVGYGVHDDWIGCNVSSYPARNVHEFLQCVHKSLEDIFSVL
EGKPLS
NT seq 2001 nt NT seq  +upstreamnt  +downstreamnt
atggcggctttggtttgggttcagcggaccgcgtctctgaggaatcccgggagtctgctc
cattcccggagcccagttttgcggcttcgctgccggtttcatgtgggcaggaaatcctgt
tcctcagagttcctgcaccggagcgtggttccgtccatgcactaccaaaaaagtctgcca
cgactacccatccccaaactggaggactccatcagcagatacctggctgcccagatgcct
ctgctggatgatgatcagttcagaaccacagagaaagtagctcaagacttcctgaagggg
gagggcagacagctgcacgaggagctggtgctcatggacaagaacaacaagcacaccagc
tacatttcagctccgtggtttgatatgtatctatctgcacgcgactctttggtgttgaac
ttcaaccccttcatgtccttcaaccccgacccgaaacaggagtacaacgacccgctggtg
cgctccaccaacatggtgtgttcagcggtgcgcttcatgaagacgctccgggccggcctg
ctggagcccgaggttttccatctgaaccctgccaaaagcgacacggccacgttcaagaag
ttcatccgctgggtcccgtcctcgctgtcctggtatggagcctacatggtgaacgcttat
cccctggacatgtctcagtactttcgtctcttcaactccacgcgcatccccaaacaaggg
cgggacgagcttttcaacgatgagaaaggccggcacctgctcgttctgaggagaggaaat
atgtacgtctttgacgttgttgatggcgatggcaacatggtgaagccggttgaggtccag
gcccacctgaagtacatcatgtctgacccaaaaccggaggcggagttcccgctgggggtc
ctgaccagcgagaaccgggatgtctgggcaggactgagggagaagctgatagccgctggg
aatgcagaggacctgggaacggtggacagcgccctcttctgcctctgcttagatgacgag
accatgaaggatcacatccacatctcccacaacatgctgcacggcgatggctgcaaccgc
tggtacgacaagtccttcagcatcatcatggctaaagacggtcaagccgccatcaacttt
gagcatgcttggggcgatggcgtcgccgttcttcgcttccaaaacgaggtcttcaaagac
accacggagcggccgctcgtgcaccccggctctacgccggcagcagactctgcctcggcc
gtgcgacagctggacttcaaactaaccagcgagctgaagaacgacatcaagaaagccaag
cagaactttgactcagccgtgtccaagctcaccatcgacgccatggagttcaagaagggc
gggaaggagcagctgaagaaaaacaagctgagtccggatgctgtggcccagctggctttt
cagatgggtttcctgaggcagtacgggcaaacggtggctacctacgagtcctgcagcacc
gcagccttcaagcacggccgcacagagaccatccggccagccactgtacacaccaagcga
tgttcccaggcttttgttcatcagccgggcgcccacagcgtggaacaactgcgcggcatg
ctgcacgagtgctccaaataccacgggcagctcacaaaagaagcagctatgggtcaagga
tttgaccgtcacctcttcgcactgcgctacctagctacctctcaaggacggccgctgcac
accttgtacacagaccccgcctatgctgccatcaaccacaacatcttgtccaccagcacc
ctcaccagtcctgctgtcagcctggggggcttcgctccagtggtgccggacgggttcggc
gtcggctatggcgtccacgatgactggatcggctgcaatgtgtccagctatccagcacgt
aacgtgcacgagttcctgcagtgcgtccacaagtctttggaggacatctttagcgttctg
gaggggaagccgctcagctga

DBGET integrated database retrieval system