KEGG   Oryzias latipes (Japanese medaka): 101168351Help
Entry
101168351         CDS       T02443                                 

Gene name
nop58
Definition
(RefSeq) nucleolar protein 58
  KO
K14565  nucleolar protein 58
Organism
ola  Oryzias latipes (Japanese medaka)
Pathway
ola03008  Ribosome biogenesis in eukaryotes
Brite
KEGG Orthology (KO) [BR:ola00001]
 09120 Genetic Information Processing
  09122 Translation
   03008 Ribosome biogenesis in eukaryotes
    101168351 (nop58)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:ola03009]
    101168351 (nop58)
Ribosome biogenesis [BR:ola03009]
 Eukaryotic type
  Sno RNPs
   Box C/D snoRNPs
    101168351 (nop58)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Nop NOP5NT Cas_Cas1
Motif
Other DBs
NCBI-GeneID: 101168351
NCBI-ProteinID: XP_023820969
Position
2
AA seq 535 aa AA seqDB search
MLVLFETAAGYAIFKVLDESKLQQVDSLYKEFETPEKANKVVKLKHFEKFTDTTEALAAA
TALVEGKIGKSLKKVLKKVVAKEAHEELAVSDAKLGGVIKDKLELSCVHSSAVAELMRCI
RSQMESLISGLPPKEMSAMSLGLAHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNNY
IMRCREWYGWHFPELGKVVVDNLAYCKTVLKIGDRTNVATTDLSEILPEEVEAEVKLAAE
ISMGTEVSEQDIANIRHLCDQVIEISDYRAQLYDYLKNRMTAIAPNLTVMVGELVGARLI
SHAGSLLNLAKHPASTVQILGAEKALFRALKTRKDTPKYGLIYHASLVGQTTAKNKGKIS
RMLAAKASLAIRYDALGEDTNAEMGIENRAKLEARLRQLEDRGIRKISGSGKAMARADKY
QHKSEVKIYDPSGDSTIPSTSKKRKFEEVEQQEAAEEPTTSGMKSKKPKKEPQVQEETPE
TSAEPETPKKKKKKKDKKAVEEPAEELKEEEEEVAVMESTEKKKKKKKKKEEDDE
NT seq 1608 nt NT seq  +upstreamnt  +downstreamnt
atgttagttttatttgaaaccgccgcaggatatgctattttcaaggttctcgatgaatcc
aagctgcagcaagtcgacagtctttataaggagtttgaaactcctgagaaagctaataaa
gtagtcaaactgaagcattttgagaagttcactgacacaactgaggctctagcagctgca
accgccctggtggaggggaaaatcgggaagagtttgaagaaagttttaaagaaagtcgtt
gccaaggaagcccacgaggagcttgctgtcagcgatgccaaacttggtggagtaattaaa
gacaagcttgagctgagctgtgtccacagctccgctgtggctgaactgatgagatgcatc
aggagccagatggagagcctcatctctggacttcctcctaaagagatgagtgccatgtcc
ctcggtttggctcacagtttatcccgttacaagctcaagttcagccccgacaaagtggat
accatgattgtgcaggccatttctctactggacgacctggacaaggagctgaataactac
atcatgcgctgtagggagtggtacggctggcacttccccgagctcggaaaggttgtcgtc
gacaatttagcttattgcaaaactgtccttaaaattggcgaccgcacaaacgtggcgacc
accgatctatcggagatccttccagaagaggtggaggcagaggtcaagctggccgctgaa
atctccatgggaacagaagtgtcggagcaggacatcgccaacattcgacatctctgcgat
caggtgatcgagatctcggattaccgcgcacagctctacgattacctgaagaaccggatg
acggccatcgctcccaacttgacggtgatggtgggcgagctggttggcgcccggctcatc
tcgcatgccggttcacttctgaatctggccaagcatccggcctccacggtgcagatcctg
ggcgcagagaaagctcttttcagagctctgaagacccgcaaagatacgcccaaatatggt
ctcatttaccacgcctccctagtgggacagaccactgccaagaacaagggcaaaatctcc
agaatgctcgctgcaaaagcgtcgctggctattcgctacgacgctctgggagaagacacg
aacgccgaaatgggaatcgagaaccgagccaagctggaggccagactccggcagctggag
gacagggggatccgtaaaatcagcggttctggcaaagccatggcgagggctgacaaatac
caacacaagagcgaggtgaaaatttacgatccatctggagactccaccatcccctccacc
tcaaagaagaggaaattcgaggaggtggagcagcaggaggctgcagaggagcccaccaca
tcggggatgaagtccaagaagccaaagaaagagccccaagttcaagaagaaacgcctgaa
acttcagccgaaccggagacgcccaagaaaaagaagaagaaaaaggacaagaaagcagtg
gaggaaccagctgaagagctaaaggaggaggaagaggaggtggcagtaatggagtcaaca
gagaaaaagaagaagaagaagaaaaagaaggaggaagatgacgaataa

DBGET integrated database retrieval system