KEGG   Oryzias latipes (Japanese medaka): 101169474
Entry
101169474         CDS       T02443                                 

Gene name
mecom
Definition
(RefSeq) MDS1 and EVI1 complex locus protein EVI1 isoform X1
  KO
K04462  ecotropic virus integration site 1 protein
Organism
ola  Oryzias latipes (Japanese medaka)
Pathway
ola04010  MAPK signaling pathway
Brite
KEGG Orthology (KO) [BR:ola00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101169474 (mecom)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:ola03000]
    101169474 (mecom)
Transcription factors [BR:ola03000]
 Eukaryotic type
  Zinc finger
   Cys2His2 developmental/cell cycle regulators, Krueppel-like
    101169474 (mecom)
SSDB
Motif
Pfam: zf-C2H2 zf-C2H2_4 zf-H2C2_2 zf-C2H2_6 zf-C2H2_jaz zf-H2C2_5 zf-C2H2_8 zf-BED
Other DBs
NCBI-GeneID: 101169474
NCBI-ProteinID: XP_011481118
Position
13
AA seq 1272 aa
MRSKGRARKLTTSDCDDNYALYPADILDDICGSDGDPALSLALAEDPASPSFSDDESSLQ
HHISFQQSGSYSPQEDGTIPLDFELRESAVPGGGLGIWSRRKVKVGEHFGPYEGEHKPCL
QDPSQGWEILDGSGHVKFCVDASKPDTGSWLKHIQFAPTATQHNLTACQVDDQIFYKVTR
EIFPGEELLLFMKAEEYSCDTMAPDIHEERQYRCEDCDQHFESRNQLLDHQKQPCGGPPS
SFLNSGEDSGLKDHEPEDLRPYSSSHGLHECKECDQVFPDVQSLEAHMLSHSEEREYKCD
QCPKAFNWKSNLIRHQMSHDSGKHYECENCSKQVFTDPSNLQRHIRSQHVGARAHACSDC
GKTFATSSGLKQHKHIHSSVKPFMCKSLRPYLCEVCHKSYTQFSNLCRHKRMHADCRTQI
KCKDCGQMFSTTSSLNKHRRFCEGKNHFTAGALFAQGMPLPGTTGLDKAALAMGHSSAGL
ADYFGASRHHSGLTFPAAPAFPFSFPGLFPSGLYHRPPLVPATTSPIRQPPHAPVAGPGT
EVSKSPLLPPSPGALESRELLKALGKDCSPEKEKLDSELHNQGSSSSTKQRNKQSDHSES
SDLDDVSTPSGSELESTSGSELESDLDSERERGAARENGKGPKRKASEGEPKSHGLMDSS
AAIDFPGPSLIPSSLDEHTAVTGAVNDSIKAIASIAEKYFGSTGLAGLQDKKAGPLPYPS
MFPLPFFPAFSPPVYPFPDRDARSTNLKADPQSPGDECKKAQGKSSSESPFDLTTKRKEE
TLASFASSKPEPSHPSGQDQPLDLSLGPRGHGRKLKEEDVKKNPTYKDEKRAVEIPKPNT
SLQHARPTPFFMDPIYSRVEKRRMSDPFETLKDKYMRPTPGFLFHPQFRLPDQRTWMTAI
ENMAEKLETFNSLKPESGDLLRTVPSMFDFRAPPSALPETLLRKGKERYTCRYCGKIFPR
SANLTRHLRTHTGEQPYRCKYCDRSFSISSNLQRHIRNIHNKEKPFKCHLCDRCFGQQTN
LDRHLKKHENGNLSGTAMSSPQSELDSSSAILDDKEDSYFNEIRNFISSTGQNQASPDPS
EEGINGGAFEEGKPLLSSHVERDLEDEEVEDLGADEDEEAEEPGDGPDKSDAKVLPSNLD
DDITQDEMDFSGANNLKTSCNTSPMRHEEEQEQSSYSALDHIRRFSDMHKLEESELSDKD
GDEEDGSFGSASLTEMVKQPLFRKSKSQAYAMMLSLAEKDSLHSAPHAPASMWHSLARAA
AESSAIQSLSHV
NT seq 3819 nt   +upstreamnt  +downstreamnt
atgaggtccaaaggcagggcgaggaaactgaccacgagtgactgcgatgataattatgct
ctctatccagctgacatcttagatgacatttgtggctctgatggtgatcctgcactgtct
ttggccctggcagaggacccggcatcaccttcgttttctgatgatgagtcttcgctgcaa
caccacatatcgttccagcaatcaggcagctattcaccacaggaagatgggaccattcct
ctggactttgaactgcgcgagtcggcagttccagggggaggtctcggcatatggagccgt
aggaaagtgaaggtcggggagcattttggaccgtatgaaggagagcacaagccttgtctt
caagacccctctcaaggctgggagatcctggatgggtccggccatgtaaaattctgcgtg
gatgccagcaaaccagatacaggaagctggctgaagcacatccagtttgcccccacggcc
acacaacataacttgacagcgtgccaggtagatgatcagatcttctacaaagtcaccaga
gaaatctttcccggtgaagagctgctacttttcatgaaggcagaggagtattcatgcgac
acaatggctcctgatattcacgaggagaggcagtaccgctgtgaggattgcgatcagcac
tttgaatcccgcaaccagctgcttgaccaccagaagcagccatgtggggggccaccttct
tcattcctaaactcaggagaggatagcgggctgaaggaccatgaacctgaagacttgcgg
ccctacagttcatcccatggtctccacgagtgcaaagagtgtgatcaggtcttccctgat
gtccagagcctggaggcccacatgctctcccactctgaagagagggaatataagtgtgat
cagtgtcccaaggccttcaactggaaatcaaacttgatccgacatcagatgtcacacgac
agcggcaaacactacgaatgtgaaaactgctcaaagcaggtgttcacagaccccagcaac
cttcaaaggcacattcgctcgcagcatgtgggggcgcgtgcccacgcctgctctgactgt
ggcaagacgtttgcaacgtcttcaggcctcaagcagcataagcacatccacagcagtgtc
aagcccttcatgtgtaagtcactaagaccctacctatgtgaggtatgtcacaagtcctac
acccagttttctaacctttgtcggcacaagcgcatgcacgctgactgccggacacagatc
aaatgcaaggactgtggccaaatgttcagcaccacgtcatccctgaataagcatcgacgc
ttctgcgaaggcaaaaatcatttcacggccggggctctctttgcccagggtatgccactt
ccaggcactactggtttggacaaagccgctcttgccatgggtcatagcagtgctggactt
gctgattattttggggccagtcgccaccatagcgggcttacctttcctgcagctcctgca
tttcctttcagcttcccaggcctctttccttctggactatatcaccgacctcccctcgta
ccagccacaacgtctcccatcagacagccacctcatgcacctgttgcagggcctggtaca
gaggtgagcaaaagtcctctgcttcctccaagccctggagctcttgagtcccgtgagctg
ctgaaagctctgggcaaagattgttcacctgaaaaggagaaactcgactcagagctccac
aaccagggttcatcttcctccacaaagcaacgaaacaagcagagcgaccactctgaaagc
agcgacctggatgatgtcagtacgcctagcggaagtgaactggagagtacgtcaggctct
gagcttgagagtgacttggacagtgagagggaaagaggggctgctcgggaaaacggcaaa
ggccccaagagaaaagccagtgaaggcgaacccaagagccacggtttgatggacagcagt
gctgccatagactttcctggcccttccctgatcccatcctcgctggatgagcacacagcc
gtaacaggggctgtgaatgactctattaaggccattgcctccattgctgagaagtacttt
ggatcaactgggctagctggcttgcaggacaaaaaagctgggcctctgccctacccttct
atgtttccattgcctttctttcccgctttttcccctccagtttacccctttccagatagg
gacgccaggtctacaaacctcaaagcggatcctcagtctccaggagatgaatgcaaaaag
gcccagggcaagtcttcgtctgagtcaccttttgacctcactaccaagcgaaaggaggaa
acattagcctcatttgcctcttccaaaccagagccctcacatccaagtggacaggatcag
ccactagatctaagtctggggcccagaggccatggacgtaaactaaaggaggaggacgta
aagaagaatcctacttacaaagatgagaagcgagcagtggagattcccaaaccaaacacc
tccctgcagcatgccagacctacacctttcttcatggaccccatttacagcagggttgag
aagaggagaatgagtgatccgtttgaaactctgaaggacaagtacatgcgaccaactcca
ggcttcctcttccatccacagtttcgtttgccagatcagagaacttggatgactgcaatt
gagaacatggcagagaagctggagactttcaactccttaaaaccagagtctggggatctg
ctgcgcaccgttccatccatgtttgacttcagagctccaccttctgcacttcctgagacg
ctgttgcgcaagggcaaagagcgctacacatgcagatactgtggaaaaatattccctcgc
tctgccaacctgacccgccacctcaggactcacacaggagagcaaccatacagatgtaaa
tactgtgaccgatccttcagcatctcctccaacctgcagcgtcacattcgcaacattcac
aataaagaaaagcctttcaaatgccacctgtgtgaccggtgcttcggtcagcagaccaac
ctggaccgtcacctcaaaaagcacgagaacggcaatctgtcaggaactgcaatgtcatcg
ccgcagtctgaactggacagtagcagcgccattttggatgacaaagaagactcctatttt
aatgaaatccgaaactttatcagcagcacgggccaaaaccaggcgtcaccagacccctcc
gaggaaggcataaacggaggtgcgtttgaagaagggaagccactgttgtccagccatgtg
gaacgcgacctggaggatgaggaggtcgaagatctgggtgctgatgaggacgaagaagca
gaggagccgggcgatggtcctgataaaagtgacgccaaagtgctccctagcaaccttgat
gacgacatcactcaagacgaaatggacttcagtggagcgaacaacttgaaaacaagttgt
aatacctctccaatgaggcatgaggaagagcaggagcagagcagctactcagccttggat
cacattcgacgtttttctgacatgcacaagctggaggaaagtgagctcagtgacaaagat
ggagatgaggaggatggatcctttggctcagcctctttgactgagatggtcaaacagcct
ctctttcgaaagtccaagtctcaggcgtacgctatgatgctgtctctggctgaaaaggac
tctctccattcggccccccacgccccggcctccatgtggcacagtctggcacgggccgct
gctgaatccagtgccatccaatccctcagccatgtatga

DBGET integrated database retrieval system