KEGG   Oryzias latipes (Japanese medaka): 101169855Help
Entry
101169855         CDS       T02443                                 

Gene name
mgll
Definition
(RefSeq) monoglyceride lipase isoform X1
  KO
K01054  acylglycerol lipase [EC:3.1.1.23]
Organism
ola  Oryzias latipes (Japanese medaka)
Pathway
ola00561  Glycerolipid metabolism
ola01100  Metabolic pathways
Module
ola_M00098  Acylglycerol degradation
Brite
KEGG Orthology (KO) [BR:ola00001]
 09100 Metabolism
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    101169855 (mgll)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:ola01002]
    101169855 (mgll)
Enzymes [BR:ola01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.23  acylglycerol lipase
     101169855 (mgll)
Peptidases [BR:ola01002]
 Serine Peptidases
  Family S33
   101169855 (mgll)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hydrolase_4 Abhydrolase_1 Abhydrolase_6 DLH Abhydrolase_2 Lipase_3 LIDHydrolase Abhydrolase_5 PGAP1 Esterase Thioesterase BAAT_C Ser_hydrolase Abhydrolase_3 DUF1057 PAF-AH_p_II
Motif
Other DBs
NCBI-GeneID: 101169855
NCBI-ProteinID: XP_004070661
Position
7
AA seq 344 aa AA seqDB search
MNAGTAAACLLAAAVSCYLYGSDMLTSLLRVSVAEEPSMPEPGAGARRSPQGVPYSELPH
IVNADGLHLFCRYWEPAAPPRALVFVVHGAGEHSGPYDEIAQRLKELSLLVFAHDHVGHG
QSEGERMNIKDFQIYVRDSLQHIDLMKSRHPDLPVFIVGHSMGGAISILTACERPSEISG
VVLIGPMVQMNPESATPFKVFVAKLLNHMMPSLTLGSIESRWVSRDKTQVEAYDNDELNY
HGRLRVSFGIQLMGAAERIEREIPSISWPFLILHGDDDKLCDIRGSKMMHEKAASSDKKL
KIYEGAYHALHHDLPEVAESVLKDVTSWITERLPDKTAAQQRSS
NT seq 1035 nt NT seq  +upstreamnt  +downstreamnt
atgaacgccgggaccgcggccgcctgcctgctcgccgccgccgtcagctgctatttgtac
ggcagcgacatgctgacatcgcttctccgcgtctccgttgcagaggagccctccatgccc
gagccgggagctggtgcgcggcggagcccgcagggagttccctactccgagctgccgcac
atcgtcaacgccgacggactgcacctgttctgccgctactgggagcccgccgctccgccc
agggctttggtgtttgttgttcatggggctggtgagcacagtgggccatatgacgagatt
gcacagagactgaaggaactgtccctgctggtatttgcgcatgaccacgttggtcatggt
cagagtgaaggggaaaggatgaacatcaaagattttcagatttacgtcagagactccttg
cagcacatcgaccttatgaagtcccgccaccctgaccttcccgtctttattgttggccac
tccatgggtggagctatctcaatcctgacagcatgtgagagaccgagtgaaataagtgga
gtggttctgataggtccaatggtccagatgaacccagagtcggccacaccattcaaggtt
tttgtggcaaagctcctgaaccacatgatgccgagcctgactctgggctccatcgagtcc
agatgggtctcacgggacaaaacacaggtggaggcgtacgacaacgacgagctgaactac
catggcagactgcgcgtgtcctttggcatacagttgatgggagccgcagagcgtatcgag
agggagatcccgtccatcagctggcctttcctgatcctccacggcgacgatgacaagctc
tgcgacatcagaggctccaaaatgatgcacgagaaagcagcaagttcagacaagaaattg
aagatctatgaaggagcctaccatgcactccaccatgaccttccagaggtggctgagtct
gtgctgaaagacgtgaccagctggatcacagaacgacttcccgacaaaacagcagcacag
cagcgcagctcgtag

DBGET integrated database retrieval system