KEGG   Oryzias latipes (Japanese medaka): 101172471
Entry
101172471         CDS       T02443                                 

Definition
(RefSeq) endoplasmic reticulum aminopeptidase 1-like
  KO
K09604  adipocyte-derived leucine aminopeptidase [EC:3.4.11.-]
Organism
ola  Oryzias latipes (Japanese medaka)
Brite
KEGG Orthology (KO) [BR:ola00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:ola01002]
    101172471
Enzymes [BR:ola01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.11  Aminopeptidases
    3.4.11.-  
     101172471
Peptidases and inhibitors [BR:ola01002]
 Metallo peptidases
  Family M1
   101172471
SSDB
Motif
Pfam: ERAP1_C Peptidase_M1_N
Other DBs
NCBI-GeneID: 101172471
NCBI-ProteinID: XP_023814106
Position
9
AA seq 743 aa
MNIELKIRGPCSMPWMLRVRMLQEISVGDGCHMYAVSSLVPSQGRKYAVMWTRICGQTDS
RVWTASRVRTLARRGRVMGGKMLTIFELVQKMDTNLERTLLLLLFALIPSSHGAQIPSPD
QPKEIPVATNGQLFPWDRMRLPKTISPLHYDLSLHPNLTTLDFTGVVRIDLDVHEDTSVV
VLHAKKMHISSALLLAPAGTRVLQVLEYPRFHQLALMSDVVLTKGRKYEVQLEFAANLSD
SYHGFYKSSYRTSTGEVRVMASTQFEATFARGAFPCFDEPAFKANFTIRIIREPRHIAIS
NMPKKWYSGDELDVRAIMDTWTLQEGFPLVTVEVKGREVRLSQERFLRTDNPSLTEGFLW
QIPLTYMTSASRSVHRFLLKTKSDVLYLPEEVDWVKFNVNMSGYYMVHYGGGGWNSIISL
LHHNHTALSGNDRASLIHNVFQLVSVEKVRLDTALELSLYLSRETEIMAVWQGFGELVPL
YKLMEKRDMPELENQMKSFIVDLFRGLIDQQEWNDSGSVSQRVLRSYLLLFACVRNYSPC
VTKATRLFNQWRDSDGTMSLPVDITMAVFMVGARTREGWDFLYEKYRTSLQMSVKRRLKW
AMAVTTMTDKLQWMMEQSLNGEVMKTQDLPDVIVSVARNPHGFKLAWDFLRTHWHTLIQK
FDLGSSTISHLVAGVTNQYSTREMLHEIRSFFDSLTEEAGSQMRCIQQSYETIEDNIRWM
DRNLPLLQAWLNKHGSRNHHQEL
NT seq 2232 nt   +upstreamnt  +downstreamnt
atgaacatcgagctcaagatcagaggtccctgctccatgccatggatgctgcgtgtgagg
atgttgcaggagatcagtgtaggggatggttgccacatgtacgccgtttcttccctcgtt
ccatcacaagggcgaaaatacgctgtgatgtggacgagaatctgtggccagacagacagc
agagtgtggacggccagcagggtgaggacgctggccaggagagggagggtgatgggaggc
aagatgctcacgatctttgaacttgtgcagaagatggataccaacttggagcgaactctc
ctgctcctactctttgctctgatcccttcatctcatggagctcaaataccaagtccagac
caacccaaggagatcccagtagctacaaatggacagctgtttccctgggaccgcatgaga
ctccccaaaaccatctccccactccactatgacctgagcctccaccccaacctcaccacc
ctggacttcaccggcgtcgttcgcatagacctggacgtgcacgaagacaccagcgttgtg
gttctccacgcaaagaaaatgcacatatcaagcgcgctgttgctcgcgccagcgggcacg
agggtcctccaggttctggagtatcctcgctttcatcagctcgccttgatgtctgacgtg
gtgctgaccaaaggcaggaagtatgaggtccagctggagtttgctgcaaacctgtctgac
agctaccatgggttctacaagagcagctaccgcaccagcaccggggaggtccgggtcatg
gcatcaacacagtttgaggcgacctttgctcgtggggcctttccctgttttgatgagccc
gccttcaaagccaacttcaccatccggattattagagagccacgccacattgccatttcc
aacatgcctaagaagtggtactcgggggatgagctggatgtcagggccatcatggacacc
tggacgctgcaggagggcttcccgctggtcaccgtggaggtcaaagggcgggaggtcagg
ctgagtcaggagcggttccttaggacggacaacccctccctcactgaagggttcttgtgg
cagatcccgttgacgtatatgaccagcgcctcccgctccgtccaccgtttccttctgaaa
acaaaatctgacgtcctgtacctgccagaggaggtggactgggtgaagttcaacgtcaac
atgagcggctactacatggtccactatggcggtgggggctggaactccatcatctccctg
ctgcatcacaaccacacagccctgagtggcaacgaccgggccagcctgatccacaacgtc
ttccagctggtcagtgtagagaaggtgaggctggacacggccctggagctgtccctttac
ctgtccagagagacggagatcatggcggtctggcagggctttggggaacttgtacctctc
tacaaactgatggagaagcgagacatgcctgagctggagaaccagatgaagagcttcatc
gtggatctgtttcgggggctgatcgatcagcaggagtggaacgactctggctcggtgtcc
cagcgagtgttgaggagttacctgctgcttttcgcctgcgtcaggaattacagtccctgt
gtgaccaaagccacgcggctttttaaccagtggagggattctgatggcaccatgagcctc
cctgtggacatcaccatggccgtgtttatggttggagctcgcacacgggaggggtgggac
ttcctgtatgagaagtaccgcacgtctctgcagatgtcggtgaagagacgcttaaagtgg
gccatggcggtcacaacgatgacggacaagcttcagtggatgatggagcagagcctcaac
ggggaggtgatgaagacccaggacctcccagatgtgatcgtctctgtcgccaggaatcct
catggctttaaactggcgtgggacttcctcagaacccactggcacacgctgattcagaag
tttgacctgggatccagcactatatcccacttggtagccggagtaaccaaccagtactcc
accagagagatgcttcacgagatacgaagcttcttcgactccctgacagaagaggcgggt
tctcagatgaggtgcatccagcagagctacgagaccatcgaggacaacatccgctggatg
gacaggaaccttcctctgctgcaggcctggctgaacaaacatggcagcagaaaccaccat
caggagttatga

DBGET integrated database retrieval system