KEGG   Oryzias latipes (Japanese medaka): 101172788Help
Entry
101172788         CDS       T02443                                 

Gene name
thnsl2
Definition
(RefSeq) threonine synthase-like 2 isoform X1
  KO
K06037  O-phospho-L-threonine phospho-lyase [EC:4.2.3.-]
Organism
ola  Oryzias latipes (Japanese medaka)
Brite
KEGG Orthology (KO) [BR:ola00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    101172788 (thnsl2)
Enzymes [BR:ola01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.-  
     101172788 (thnsl2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Thr_synth_N PALP YjeF_N Peptidase_M3_N
Motif
Other DBs
NCBI-GeneID: 101172788
NCBI-ProteinID: XP_023816361
Position
12
AA seq 503 aa AA seqDB search
MSGRVGHVTQAESSTMQYCSTRGGVGGWSFRDVLFSGYAPDGGMFMPETLPVLDPDALRS
WRGLSYPRVVVEVASLFIPPQLIPRDDLGVLVEEALSGFSVPEVVRVARLKDGLTVLELF
HGETLAFKDLAMSCTVHFLSYFLKKESRRAVVVVGTSGDTGGSAIQSAKGLPGLDVVVVY
PRGRVTPVQEKHMTTCLEDNVHVFAADGSSDDIDQPLRRLFADQQLVLSHGLMSLNSVNW
SRILIQLAHFVYAYLELSEVERAEPGAALPELEVVVPTGGAGNIAAAFIVKQMGVPLRLV
AMVNANDIVHRTVTRGDFSMADKVTQTLATAIDIQDPYNMERVFWLLLGRDGASVKAMME
EFQRSHRHSLSEEQRRLLSDVLSTGAVSDEGILETMRRCWEENLYLLCPHTAVAVWHHYH
CPHSWGVNRCYVATASPAKFQAAVQKAGLPFSPPAALQALDGLPTRCQELRRSADWSKDW
EDRLRRHIQDVYAARKSRSAPPP
NT seq 1512 nt NT seq  +upstreamnt  +downstreamnt
atgagcggccgcgttggacatgtgacgcaagcagagagctcaaccatgcagtactgcagc
acccggggcggggtggggggctggagcttcagggatgtgttgttctccggctacgctccg
gatgggggcatgttcatgccggaaacgctaccggtgctggaccccgacgcgctgaggagc
tggagggggctgtcctaccccagagtggtggtggaggtggcgtctctgttcatcccccct
cagctcatccccagagacgacctgggggtcctcgtggaggaggccctctctggtttctct
gtgcctgaggtggtccgggtagctaggctgaaggatggcctgaccgtgttggagcttttc
cacggagaaactctggcttttaaggatctggccatgagctgcaccgtccactttctctcc
tacttcctgaagaaagagagccgcagagctgtagttgttgtaggtacctccggtgatact
gggggctcggccatccagagtgccaaaggcttgcctggtttggatgtggtggtggtttac
cctcgaggacgtgtcaccccggtgcaggagaagcacatgaccacatgcctggaggataac
gtgcacgtatttgcagccgatggcagctctgacgacatcgaccagcctttgaggcgcctg
tttgctgaccagcagctggtgctgtctcatgggttaatgagcctcaactcggtgaactgg
tccagaatcctaatccagctcgcacacttcgtctacgcttacctggagctcagtgaagtg
gagcgggctgagccgggggcggctctgccagagctggaggtcgttgttcccacaggagga
gcaggaaacatcgcagctgcgttcatagtgaagcagatgggggtgcctctgaggctggtt
gccatggtgaacgccaacgacattgtgcacaggacggtaacccgtggcgatttctccatg
gctgataaggtcacgcagactttggccacagccatagacatccaggacccgtacaacatg
gagcgagtgttctggctcctgctgggcagagatggcgcctctgtcaaagccatgatggag
gagttccagcgttcacaccgccactcgctgtcagaggagcagcgcagactgctgtcggac
gtcctgtccacgggggcggtgagcgatgagggcatcctggagactatgaggaggtgctgg
gaggagaacctgtacctcctgtgtcctcacaccgctgtggcggtgtggcatcactaccac
tgtcctcacagctggggggtcaacaggtgttacgttgcaacggcatccccagccaagttc
caggcggcggtacagaaggccggcctgcccttcagcccccccgcggcgctgcaggctttg
gacgggctgcccacccgctgccaggagctgcggcgcagcgccgactggagcaaagactgg
gaggacagactccgacgccacatccaggatgtttacgctgccaggaagagcaggtcggct
ccgcccccctga

DBGET integrated database retrieval system