KEGG   Oryzias latipes (Japanese medaka): 101172802Help
Entry
101172802         CDS       T02443                                 

Definition
(RefSeq) leukotriene B4 receptor 1
  KO
K04296  leukotriene B4 receptor 1
Organism
ola  Oryzias latipes (Japanese medaka)
Pathway
ola04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:ola00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    101172802
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:ola04030]
    101172802
G protein-coupled receptors [BR:ola04030]
 Rhodopsin family
  Lipid
   Leukotriene
    101172802
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7TM_GPCR_Srx LST1
Motif
Other DBs
NCBI-GeneID: 101172802
NCBI-ProteinID: XP_004067442
UniProt: H2M8W5
Position
3
AA seq 337 aa AA seqDB search
MNPFTVESPTEAPEEYGTGTALACVILGLSFLIGVPGNLFVIWTILRSMKKRSHTVMLIL
HLAVADTVVLITLPLWIYSMAHTWEFGEGTCKALVYFISTCMYSSIFFITLMSVERFVAI
SHPFVMLRWGSKGSMNTFLLFLWLLAFSLGTPAILTQTLNEAGGVTQCFSREFSTDTQAI
IIVCLETLAGFVLPLIILSICSCHVSMKIKKLSFNSKPKSVVLIHAVLIAFILCWLPHHI
INIITVISLVISDTEQEYVPEYLVLSSGALVFISSSVNPMLYAFFAKNFRGSLEGSRLVR
LFQEMTVYTNKLRELAVQQQSDQGPSTQEVLISDSTC
NT seq 1014 nt NT seq  +upstreamnt  +downstreamnt
atgaatcccttcactgtggaatcccccacagaggctcctgaggagtatggcaccgggact
gcactggcatgcgtcattctgggcctgtcttttttgatcggagttccaggaaacctgttt
gtgatttggaccatcctgagatccatgaagaagcgttcacacacggtgatgctcatcttg
catcttgctgttgcagacaccgtggtcctcatcaccctgcctctgtggatttactccatg
gcgcacacctgggagtttggagaaggaacctgcaaagctttggtgtacttcatcagtacc
tgcatgtacagcagcatcttcttcatcactctaatgagtgtggaacgttttgtagcgatt
tctcatccatttgtaatgctgcgctgggggagcaaaggttctatgaacacatttcttcta
tttttgtggctccttgccttttctcttggaacgccagccatcctgacccaaactttaaac
gaagctggtggagttacccagtgtttttctagagagttcagcactgatacccaagcaatc
atcatcgtgtgcctggagacactagcaggatttgtacttcctttaatcattctttccatc
tgtagctgtcatgtcagcatgaaaatcaagaaactgagttttaattcaaagccaaagtca
gtggttcttattcacgctgtgctgattgctttcatattgtgttggttgcctcaccatatt
atcaacatcattactgtcatttccctggtgatatcagacactgaacaggaatacgtccct
gagtatcttgtcttaagctctggtgctcttgttttcattagcagctcggtaaatcccatg
ttgtatgctttctttgcaaagaatttcagaggaagtctggaaggctctcgcctggttagg
ctgtttcaggaaatgactgtttatacaaataaactcagagagctggcagtacagcagcag
tcggatcaggggccatccacccaggaagtgttaatatctgatagtacatgttaa

DBGET integrated database retrieval system