KEGG   Oryzias latipes (Japanese medaka): 101173208Help
Entry
101173208         CDS       T02443                                 

Definition
(RefSeq) 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase delta-3-A
  KO
K05857  phosphatidylinositol phospholipase C, delta [EC:3.1.4.11]
Organism
ola  Oryzias latipes (Japanese medaka)
Pathway
ola00562  Inositol phosphate metabolism
ola01100  Metabolic pathways
ola04020  Calcium signaling pathway
ola04070  Phosphatidylinositol signaling system
ola04933  AGE-RAGE signaling pathway in diabetic complications
Module
ola_M00130  Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Brite
KEGG Orthology (KO) [BR:ola00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    101173208
 Environmental Information Processing
  Signal transduction
   04020 Calcium signaling pathway
    101173208
   04070 Phosphatidylinositol signaling system
    101173208
 Human Diseases
  Endocrine and metabolic diseases
   04933 AGE-RAGE signaling pathway in diabetic complications
    101173208
Enzymes [BR:ola01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     101173208
Membrane trafficking [BR:ola04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Phospholipases
    101173208
 Endocytosis
  Macropinocytosis
   Phospholipase C
    101173208
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PI-PLC-X PI-PLC-Y EF-hand_10 EF-hand_like C2 EF-hand_7 EF-hand_6 PH EF-hand_1 SPARC_Ca_bdg PH_12 PH_2 EF-hand_8
Motif
Other DBs
NCBI-GeneID: 101173208
NCBI-ProteinID: XP_004086893
Position
19
AA seq 770 aa AA seqDB search
MLGARRKDAGKSETTAIDPLRNLGIQEDEDVKKMLQGSSMVKVRSPRWQKRRTLRLLEDG
VTVWCQSHKSSSRAKEQQSFSVMEVECVREGCQLEALRHMTGSESTKRCLTVVFKGPRKS
LELLCQSEEEAQQWARGIRTLQERMDNMTHKEKLDHWIHAYLSRADENHDDKMSYEEVQR
LLRMINVDLSDQYARSLFQKCDHSADGRLDHEEIEVFCRELLRRPELDTIFIQHSANGCV
LSTVDLRDFLKKQEEDCSVTHAQSLILTYELNEWAQKNHLMTPNGFTMYMLSKQNCVFNP
DHARVYQDMTQPLAHYFISSSHNTYLTKDQMTGDSSTEPYIRALSHGCRCVELDCWDGDG
GEPVIYHGHTLTSKVPFVDVIKIINEYAFKASSFPLILSLENHCSVEQQAVMARHLRSIL
GEKLLQRPLSTEKSKCLPSPEDLKGKILVKGKREESAEECSSSSSDLNSSDDETSVAEGR
SKKKKDGKKAGVSKLNPELSELVVYTRSVHFKGFDQAAKSSPLQMSSFSEREALKLIKDS
GVLFVRHNSHKLSRIYPSGQRLQSSNYNPQQMWNAGCQIVALNFQTPGELMDLNQGRFLQ
NGLCGYVLKPPFMCTPDSTFNPENVGGGPGHRPILLTIRVISAQQLPKPECDKPSSIVDP
QVWVEIHGVPIDNNKEKTHYVENNGFNPQWNCTLNFTVHVPDLALVRFMVEDHDYTSSND
FLGQYTLPFTSMRSGYRHVPLFKLDGSSLSPSALFIHVKFSTCQSSPSRS
NT seq 2313 nt NT seq  +upstreamnt  +downstreamnt
atgctgggagccaggaggaaagacgccgggaagtccgagacgacggccatcgacccccta
agaaacctcggaatccaggaggatgaggatgtgaagaagatgctgcagggctccagcatg
gtgaaggttcgctccccacgttggcagaagcgcaggactctgcggctgctggaggatgga
gtcactgtgtggtgccagtcacacaaatcatccagccgggccaaagagcaacaatccttc
tctgtcatggaggtggagtgtgttcgcgaaggctgccagttggaggcactgcgccacatg
acgggctccgaatccacgaagcggtgtttgacagtggttttcaagggaccacgtaagagt
ctagaactcctctgccagagcgaggaggaggctcagcagtgggcccgtggcatcaggacc
ctgcaggagcggatggacaatatgacccacaaggagaaactagaccattggattcatgct
tacctgagccgggcagacgagaaccatgacgacaagatgagctacgaggaggtgcaaaga
ctgctgcgcatgatcaacgtggacctgagcgatcagtacgcccgcagccttttccagaaa
tgtgatcactctgctgatggccgcctggaccatgaagagattgaagtcttctgcagggag
ctgttacgaagaccagaactggacaccattttcatccagcactcggcaaacggctgcgtg
ctctccactgtggacttgagggacttcctaaagaagcaggaggaggactgctctgtgact
cacgcccagagcctcatccttacctacgagctcaacgagtgggcccagaagaaccatctg
atgactcccaatgggtttaccatgtacatgctgtccaagcagaactgtgtattcaatcca
gatcacgcccgggtctaccaggacatgacgcagccattggctcactacttcatctcttca
tctcacaacacctacctcaccaaggaccagatgaccggggacagcagcactgagccatac
atacgagctctgagccatggctgtcgctgtgtagagctggactgctgggatggagatgga
ggggagcctgtcatctaccatggacacaccctgacctccaaagtgccctttgttgacgtc
atcaagatcatcaatgagtacgccttcaaggcgtcctcctttcctctgatcctctctctg
gagaaccactgctctgtggaacaacaagctgtcatggcccgacacctgcgctccattctt
ggggagaaactactgcagcggcctctcagcacagagaagtccaaatgccttccttcccca
gaggatctaaagggtaagatcctggtgaaggggaagagggaagagtcagcagaggagtgt
tcctccagttcttcagaccttaactcttcagatgacgagaccagcgtggcagaagggaga
tccaagaagaagaaagatggcaaaaaggctggtgtgtcaaagctgaatccagagctgtct
gagttggtggtatacacccgcagcgttcactttaagggttttgatcaagctgccaaaagc
tcgccactccaaatgtcgtccttctctgagagagaagcactcaagcttattaaggattct
ggggtcctctttgtgcgccacaatagtcacaagctcagcaggatttacccatctggccag
cgcctccagtcctccaactacaaccctcagcagatgtggaatgcaggctgtcagatcgtt
gctctgaacttccagacacctggcgagctgatggacctgaaccaaggccgttttctgcag
aacggtctgtgtggatatgttctgaagcctcctttcatgtgcacacctgacagcaccttc
aaccctgaaaacgttggaggaggccccggtcacagacctatcctcctcaccattcgggtc
atttcagctcagcagctcccaaaaccagaatgcgacaaacctagctctattgtggaccct
caagtttgggtggagattcatggagttcctattgacaacaacaaggagaaaactcattat
gttgagaacaatggctttaacccacagtggaactgcaccttgaatttcaccgtccatgtt
cccgacttggctctggtccgcttcatggtggaggatcacgactatacctcaagcaatgac
ttcctaggacaatacacgttacctttcaccagtatgcggtcaggttaccgacatgttccc
ttgtttaagcttgatgggtccagcctttcaccctctgcactcttcatccatgtgaagttc
agcacctgtcagagcagtccatccagatcctaa

DBGET integrated database retrieval system