KEGG   Oryzias latipes (Japanese medaka): 101173638Help
Entry
101173638         CDS       T02443                                 

Definition
(RefSeq) 5-hydroxytryptamine receptor 4 isoform X1
  KO
K04160  5-hydroxytryptamine receptor 4
Organism
ola  Oryzias latipes (Japanese medaka)
Pathway
ola04020  Calcium signaling pathway
ola04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:ola00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    101173638
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    101173638
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:ola04030]
    101173638
G protein-coupled receptors [BR:ola04030]
 Rhodopsin family
  Biogenic amine
   Serotonin
    101173638
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1 Git3
Motif
Other DBs
NCBI-GeneID: 101173638
NCBI-ProteinID: XP_011478864
Position
10
AA seq 399 aa AA seqDB search
MNVSAAGQMLVMEELVSESDSMPKRIALICFLSLVMLMSVLGNLLVMVAVCKDRQLRKIK
TNYFIVSLAFADLLVSVLVMPFGAIELVHQHWIYGETFCLVRTSLDVLLTTASILHLCCI
ALDRYYAICCQPLVYRNKMTPMRVALMMGGCWVIPTFISFLPIMQGWNSIGIDHVIEERR
HSGGSNTTSCVFMVNKPYALTCSLVAFYIPLVLMVLAYQRIYVTARAHALQISMLQRAGG
AGAPGTSGVSADSADHQRNHRMRTETKAAKTLCIIMGCFCLCWAPFFVTNVVDPFIDYRV
PDQLWTACLWLGYINSMLNPILYAFLNKSFRRAFLIILCCGRKRYRRPSILASGAACAAT
QINGSTHVLKYSVLHNGNHKEQEKKPLHPNTESSHESCL
NT seq 1200 nt NT seq  +upstreamnt  +downstreamnt
atgaatgtcagcgctgcaggccagatgctggtgatggaggagcttgtcagtgagagcgac
agcatgccaaagcggatagccctgatctgcttcctgtctctggtcatgctgatgagcgtc
ctgggaaacctgctggtcatggttgcagtctgcaaggacagacaactcaggaaaatcaag
accaactatttcatcgtgtctctggcgttcgctgacctgcttgtgtcggtcttggtgatg
ccgttcggcgccatcgagctggtccaccagcactggatctacggagagaccttctgcttg
gtgcggacgtcgctggacgtcctgctgaccactgcctccatccttcacctgtgctgcatc
gctctggacaggtactacgctatctgctgccagcctctggtctaccggaacaaaatgacg
cccatgcgagtggctttaatgatgggtggctgctgggtcattcccacgttcatctccttc
ctgcccatcatgcagggctggaacagcatcggcatcgaccacgtgatcgaggagaggcgc
cacagcgggggcagcaacaccacctcctgtgtcttcatggtcaacaagccatacgccctc
acctgctccctggtggccttctacatccccctggtgctgatggtgctggcctaccagagg
atctacgtcacagctcgggcccacgccctgcagatcagcatgctgcagcgggcgggagga
gccggggcccctgggacgtcgggggtgagcgccgactcggcagaccatcaacgcaaccac
cggatgcgaacagagacaaaggcggcaaagactctctgcatcatcatgggatgcttctgc
ctctgttgggcgccattcttcgtcaccaacgtggtggatccgtttatagactacagggtg
ccggaccagctgtggaccgcctgtctctggctgggctacatcaactccatgctgaacccc
atcctctacgccttcctcaacaagtccttccgccgtgccttcctcatcatactgtgctgt
gggagaaagaggtaccgcaggccctccatcctggcgtcgggcgccgcctgcgcagccacg
cagatcaacggctccacgcatgttctcaagtattctgtccttcacaacgggaaccacaaa
gagcaggagaagaagcctctgcacccaaacacagagtcctcccacgagtcctgtttgtga

DBGET integrated database retrieval system