KEGG   Oryzias latipes (Japanese medaka): 101174009Help
Entry
101174009         CDS       T02443                                 

Gene name
tpp2
Definition
(RefSeq) tripeptidyl-peptidase 2 isoform X1
  KO
K01280  tripeptidyl-peptidase II [EC:3.4.14.10]
Organism
ola  Oryzias latipes (Japanese medaka)
Brite
KEGG Orthology (KO) [BR:ola00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:ola01002]
    101174009 (tpp2)
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:ola03110]
    101174009 (tpp2)
Enzymes [BR:ola01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.14  Dipeptidyl-peptidases and tripeptidyl-peptidases
    3.4.14.10  tripeptidyl-peptidase II
     101174009 (tpp2)
Peptidases and inhibitors [BR:ola01002]
 Serine peptidases
  Family S8: subtilisin family
   101174009 (tpp2)
Chaperones and folding catalysts [BR:ola03110]
 Intramolecular chaperones
  Subtilisin family
   101174009 (tpp2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_S8 TPPII TPPII_N
Motif
Other DBs
NCBI-GeneID: 101174009
NCBI-ProteinID: XP_023809161
Position
3
AA seq 1279 aa AA seqDB search
MAAHSSEEPFPFHGLLPKKETGAASHLSRFPEYDGRGVLIAILDTGVDPGAPGMQVTTEG
KPKIVDIIDTTGSGDVNMTTVAEAKDGTITGLSGRILKIPPAWVNPTGKFRIGVKNGYEF
FPKALKERIQKERKEKIWDPAHRAALAEVCRKLDEFELSHPTPSQSEKLQKEELQSQSEL
LASLEKKYSDPGPVYDCVLWHDGVTWKAVVDTSECGELSQCTVLSSYKENQEYASLGTVE
MLNYSINIYDEGSTLCIVTSGGAHGTHVASIAAGYFPEEPERNGVAPGAQILALKIGDTR
LSTMETGTGLIRAMIEVINYKCDLVNYSYGEATHWPNSGRICEVITEAVQKHNVIFVSSA
GNNGPCLSTVGCPGGTTSSVIGVGAYVTPDMMVAEYSLREKLPPNQYTWSSRGPSTDGAL
GVSISAPGGAIASVPNWTLRGTQLMNGTSMSSPNACGVIALVLSGLKQIGIRTCVPAVRR
ALENSALKVEDIEVFAQGHGIIQVDRALDYLTQNASLPTSQLGFTVSVGSQRGIYLRDPS
QVLAPSDHSVGIEPIFPENTENSERISLQLHLALTCTAPWVQCPSHLELMNQCRHVNVRV
DPLGLREGVHYAEVCGYDTAAPGCGPLFRVPITVIIPVKVTNSRNQEVSFTDVHFRPGQI
RRHFITVPQGASWAEITLTSHSGDVSSKFVLHAVHLVKQKAYRANEFYKFSSLLERGSLT
EAFPVLSGRVVELCIARWWASLGDVTVDYSISFHGLCVSPLPLHIHASEGVASFDVSSPL
RYEEVSPSITLKSWVQPLRPLSSKIKALGMRDVLPNNRQLYEIVLTYNFHQPKSGEVTPS
CPMLCELLYESEFDSQLWMLFDQNKRLLGSGDAYPHQYALKLEKGDYSVRLQVRHEQSNE
LERLKDLPFVVSHRLSTTLSLDIYETHRAALMGKKKANSVTLCPGTTHPFYITGLPDDKI
PKGTSPGCYILGSLIVPKSEYGKKAGQASAKRQGKFKKDIIPVIYHLIPAPNKTKNGGKE
KEKDKEGDKEKDVKEEFAEAMRDLKIQWMTKLDSSSVYDELVELYPDYLPLHVQRLHQLD
NEKERVKHLGEVVSAADVVISHIDQTVLAVYLSLKTDPRPDAASIKTDMEKQKSSLLDAL
CRKGCALADQLLLPSATQDGAGAVYAGQTPATEAVEQVASSCDDVLQNVATALTDVFWEV
QKWAELTDTKVLSFSYKHALVSKMYGRALKYASKMVEEKPSKENMRNCIQLMHQLGWTHC
SAFSENWLPVMYPADYTPF
NT seq 3840 nt NT seq  +upstreamnt  +downstreamnt
atggctgctcattctagtgaagaaccgttccccttccacggactgctccccaagaaagag
accggcgccgcctcccatctgtccaggttccccgaatatgacgggcgaggggtgctcatc
gctatcctcgacaccggagtggatcccggtgcccccggcatgcaggtcacaactgaaggg
aagccaaagattgtggacatcatcgataccacaggcagtggggacgtgaacatgactacg
gtggcagaagccaaagatgggacaatcactggtctgtctggtagaatacttaagattcct
ccagcatgggtcaatccaacagggaagtttcgcattggagttaaaaatggctatgaattc
ttccccaaggctcttaaagaaaggatacagaaagagcgaaaggagaaaatatgggatccg
gcacacagagcggcacttgctgaggtctgtcgcaagttagacgagtttgagctctcccat
ccgactccttcacagagtgagaagctgcagaaagaagagctgcagagtcagtcagagctt
ctagcatccctggaaaagaagtacagcgatcctggtcctgtgtatgactgtgtgctctgg
catgacggagtcacgtggaaggctgtggtggacacatctgagtgtggggaactgtcgcag
tgcactgtgctcagctcctacaaagaaaaccaagagtatgcctcattaggaactgtggag
atgcttaattattccataaacatttacgacgagggaagcacactctgcatcgtcaccagt
ggaggggctcatgggacacatgttgcaagcattgcagctggctacttcccagaggaaccc
gagcgtaacggtgtggcccctggtgcacagattctggctctgaaaattggtgacactcgc
ctcagcaccatggaaacgggaactggactcatacgcgccatgattgaagtcatcaactac
aagtgtgacctggtgaattatagctacggggaagccacccattggcccaactcagggagg
atttgtgaagtgatcacagaggctgtgcagaagcacaatgtgatttttgtgtccagtgcg
gggaacaatggcccctgcctttccactgttggttgtcctggaggaaccaccagcagtgtc
ataggggttggcgcttatgtgaccccagacatgatggtggcagagtattcccttcgagag
aagctgcctcccaaccagtacacctggtcgtcgcggggccccagcactgatggagccttg
ggggttagcatcagtgctcccggcggcgccatcgcatctgttccgaactggacgcttcgg
gggacacagctgatgaatggcacatccatgtcatccccaaatgcctgtggagtcatcgca
ctagttctctcaggtctgaagcagattgggatccgtacgtgtgttcctgctgtgaggaga
gcgctggaaaactcggctcttaaagttgaagacatagaagtgtttgcacagggacatgga
atcattcaggtggacagagcgttagactacctcactcagaacgcttctttacccacaagc
cagctcggtttcacagtcagtgtggggtcacagagaggcatttacctcagggatccatcc
caggtccttgcaccttcagatcacagtgttggaattgaacccatctttccagaaaacaca
gaaaactctgagcgaatctccttgcagctccacttggccctcacctgcactgcgccgtgg
gttcagtgtccctcccatctcgagctgatgaaccagtgtcgtcacgttaatgttcgcgtc
gatcctctgggactgagagaaggagtgcattacgcagaggtgtgtggctacgacacagca
gcacccggctgtggcccgctgttccgagtgccaatcacggttattatacctgtcaaagtg
acaaacagtcgtaaccaggaggtgagtttcacagatgtccactttagaccaggacagatc
agacggcactttatcaccgttcctcagggagcctcttgggcagagatcacactgacgtct
cactcaggagacgtgtcatcaaagtttgttcttcatgcggtgcacctggtcaagcagaaa
gcctatagagcgaacgaattctacaagttctcctcattgttggagagaggatctctaaca
gaggctttccccgttttgtcgggtagggttgtggagctgtgcatagctcgttggtgggct
agtctgggagacgtcactgtggactacagcatctcgttccatggcctctgtgtttctcct
ttgccgctccacatccacgcttcagagggagtggctagttttgacgtgtcttcgcctcta
cggtatgaggaggtttctccctcaatcacccttaaatcatgggtacaacctctgaggcct
ttgagttcaaagataaaggccttgggaatgcgagatgttctacccaataacagacaactc
tatgagattgtccttacctacaactttcaccagcctaagagcggtgaagttacgcccagc
tgccccatgctgtgcgagctcctatacgagtctgaatttgacagtcagctgtggatgctg
tttgaccaaaacaagaggctgcttggttcaggagacgcctacccgcatcagtatgcgctg
aagcttgagaagggggactacagcgttcgccttcaggtccgtcacgaacagtccaacgag
ctggagcgcctgaaagacctgccgtttgtggtttctcatcgtttatccacaaccctcagt
ctggatatctacgagacccaccgggcggctctcatgggcaagaagaaggcaaactccgtc
actttgtgtccgggtaccacacatccattttacatcactggtctgccagatgacaagatt
cctaaaggaacaagtccaggctgctacattttgggatctctcattgtgcctaagagcgag
tatggcaagaaagcagggcaggcttccgcaaaacgacaaggaaaatttaaaaaggatatt
attccagtcatctaccacttgattcccgctcccaacaaaacaaagaacggtgggaaggaa
aaggagaaggacaaggagggagacaaagagaaggatgtgaaggaggagtttgcagaggct
atgagagacttgaaaattcagtggatgacaaagttagattccagctcagtctatgatgaa
ctggttgaactctatccagattaccttccgctgcatgtgcagaggctgcatcagctggac
aacgaaaaggagcgtgtgaagcatctcggagaggtggtgtccgcagcagacgtggtcatc
tcgcacatcgaccaaacagtcttagccgtgtacctctccctgaagactgatccccggccg
gacgccgcttccatcaagacagacatggagaagcagaagtcctctttgctggacgcgctg
tgcaggaaaggctgcgctctggctgaccagctgctgctgccctctgccacgcaggatggc
gccggcgccgtctatgcaggacagactccagcaacagaggccgtggagcaggtggccagc
agctgtgatgatgtcctgcagaacgtggccacggctctcacagatgtattttgggaggtt
caaaaatgggcggagctaaccgacactaaggttttgtcgttttcctacaaacacgctctc
gtgagtaagatgtatgggcgagccttaaaatatgcttccaagatggtggaggagaagccc
agcaaagagaacatgagaaactgcatccagctcatgcatcaacttggatggactcactgt
tctgcgttcagcgagaactggcttcctgtcatgtatcctgcagactacacacccttctaa

DBGET integrated database retrieval system