KEGG   Oryzias latipes (Japanese medaka): 101174333Help
Entry
101174333         CDS       T02443                                 

Definition
(RefSeq) multiple inositol polyphosphate phosphatase 1-like
  KO
K03103  multiple inositol-polyphosphate phosphatase / 2,3-bisphosphoglycerate 3-phosphatase [EC:3.1.3.62 3.1.3.80]
Organism
ola  Oryzias latipes (Japanese medaka)
Pathway
ola00010  Glycolysis / Gluconeogenesis
ola00562  Inositol phosphate metabolism
ola01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ola00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    101174333
   00562 Inositol phosphate metabolism
    101174333
Enzymes [BR:ola01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.62  multiple inositol-polyphosphate phosphatase
     101174333
    3.1.3.80  2,3-bisphosphoglycerate 3-phosphatase
     101174333
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: His_Phos_2
Motif
Other DBs
NCBI-GeneID: 101174333
NCBI-ProteinID: XP_004086827
UniProt: H2N2G9
Position
19
AA seq 467 aa AA seqDB search
MFRVSAPGQRRLLAGLSLVLARLCCCSAAAANVPNIAVYFGTKTRYEEVNRHLLRDVLAV
NASVLKPPPTERCSPVHLTAVIRHGSRYPTVKNVRRINRLSELVRTEASRAPGGWLLDLQ
SRWETWYTEDMDGQLVTKGREELQQLARRLASLFPSLLSEENVRKRRVSFVSSSKHRCVS
SVEAFQEGLWQHWGPSGETPAYSHRVEDELMRFFERCRGFVEGVENNRTALLEVEKFKHG
EQMEAVRRRIAEMLGLPFHRLTPDLLEAAFFLCSYELSIKSLHSPWCFLFSETDAKVLEY
KSDLKQYWKRSHGHAISSLASCPLFHHVFRTLDKAGRPRRSTEAAPEPASILVGHAETLL
PLLSLLGLYKDETPPTASNYQSQHGRTFRTSRIVPYAANLLFVLYDCQRGPRLQMLLNET
PLRFPDLPEDAPLYRDVRAAYRHLLDGCDFHTECEGRAGGRGPSTEL
NT seq 1404 nt NT seq  +upstreamnt  +downstreamnt
atgttccgcgtgtctgcgcctgggcagcggcgtctgttggcgggtctgagcctggtcctg
gcccgtctgtgctgctgctctgcggcggctgccaacgtcccgaacatcgccgtctacttc
ggaaccaagacccgctacgaggaggtgaaccggcacctcctgcgcgacgttctggcggta
aacgcgtccgtcctgaagcccccgccgaccgagcgctgctctccggtccatctgaccgcc
gtcatacggcacggcagccggtacccgaccgtgaagaacgtccgcaggatcaacaggctg
agcgaactggtccggaccgaggcttcccgagccccgggcggctggctgctggacctccag
agccgctgggagacgtggtacaccgaggacatggatggtcagctggtgacgaagggcagg
gaggagctccagcagctggcgcggcgtctggcctccttgtttccgtctctgctgtcggag
gagaacgtgaggaagaggagggtgagcttcgtgagcagctccaagcatcgctgtgtgagc
agcgtggaggcgtttcaggaggggctgtggcagcactggggtcccagcggtgagactccg
gcctacagccaccgggtggaggacgagctgatgcgcttctttgagcgttgccgtggtttc
gtggagggtgtggagaacaaccggacggcgctgctggaggtggagaagttcaaacacggg
gagcagatggaggccgtgaggaggaggattgccgagatgttgggactcccgttccatcga
ctcacaccagacctgctggaggcggccttcttcttgtgctcgtacgagctgtccatcaag
tccctccactcgccgtggtgcttcctgttcagcgagactgacgccaaggttctggagtac
aagtcggacctgaagcagtactggaagcgctctcacggtcacgccatcagcagcctggcc
agctgtcctctcttccaccatgtcttcaggacgctggacaaggcgggccgtcctcgcagg
tccacagaagcggctccagaaccggcctccatcctggtgggacacgccgagacgctgctt
ccccttctttctctgctggggttgtataaggacgagactccgcccactgccagcaactac
caatcacagcatggcagaaccttccggaccagccgcatcgtcccgtacgccgccaacctg
ctcttcgttctttacgactgccagcgcgggccgcgcctgcagatgctgctgaacgagacg
ccgctgaggttccccgacctgccggaggacgcgccgctgtaccgcgacgtccgggccgcc
taccgccacctgctggacggctgcgactttcacacggagtgcgaggggagagccggcggg
cgcgggcccagcaccgagctctga

DBGET integrated database retrieval system