KEGG   Oryzias latipes (Japanese medaka): 101174616Help
Entry
101174616         CDS       T02443                                 

Gene name
ick
Definition
(RefSeq) serine/threonine-protein kinase ICK isoform X1
  KO
K08828  intestinal cell (MAK-like) kinase [EC:2.7.11.22]
Organism
ola  Oryzias latipes (Japanese medaka)
Brite
KEGG Orthology (KO) [BR:ola00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ola01001]
    101174616 (ick)
Enzymes [BR:ola01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.22  cyclin-dependent kinase
     101174616 (ick)
Protein kinases [BR:ola01001]
 Serine/threonine kinases: CMGC group
  RCK family [OT]
   101174616 (ick)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Haspin_kinase TFIIA
Motif
Other DBs
NCBI-GeneID: 101174616
NCBI-ProteinID: XP_023819226
Position
15
AA seq 667 aa AA seqDB search
MNRYTNIRQLGDGTYGSVILGRSLESGELVAIKKMKRKFYSWEECMNLREVKSLKKLNHA
NVIKLKEVIRENDHLYFIFEYMKENLYQLMKDRTRLFPESAVRNIMFQILQGLAFIHKHG
FFHRDMKPENLLCMGPELVKIADFGLAREIRSRPPYTDYVSTRWYRAPEVLLRSTSYSSP
IDQWAVGCIMAELYTLRPLFPGSSEVDTIFKICQVLGTPKKTDWPEGYQLASAMNFRWPQ
CVPSNLKTLIPNASAEAIHLMTDFLQWDPRKRPASAQALRYSYFHVGQALGTPQQILEQG
RPQRSLVQLQSQQNLLQQQQQQQPLLLKPLPPSQPPPNQHTSPSRPLHQIQPSPASATTP
AAAYQRHADLPREQQPKHILKQDQLETTPQRHLPFIVDNSLQHKQMRQEPENENLLSYQL
KAKGGGRRRWGQGVGSLKGEDWDDYDEVDVSSILGKNSFSSEKTMQGEDALSRYGKVLDF
SRPNGKEEAPLNLNKTGPYQEPSRTASAKQHYLRQSRFLPGISTKKNVAQNVSKDLAANQ
LWGSSSIPFGGTLPSRGAYGKVPFIPASCRSSRLIIVTSFYSGTNTIPGGYMPSFSKDSG
SAGHRGRQGVATETTASNYATWRSGRSHLNASVNTPTANKSTPGLLPRPPLQTIHGRTDW
SAKYGHR
NT seq 2004 nt NT seq  +upstreamnt  +downstreamnt
atgaatagatacacaaacataagacagctcggagacggcacctacggctcagtcattctg
ggccgcagtttggagtccggagaactagttgccataaaaaaaatgaaaagaaagttctac
tcttgggaagaatgcatgaaccttcgggaagtaaagtccctgaagaaactcaaccacgct
aatgtcatcaaactcaaggaggtgattcgcgaaaacgaccacttgtacttcatatttgag
tacatgaaagaaaatctgtatcagctgatgaaagacaggactcggttgtttcccgaatct
gctgtaagaaatattatgtttcagatcctgcaggggctagcattcatccataaacacggg
tttttccacagagacatgaaaccagagaaccttttatgcatgggcccagagctggtgaaa
atagcggactttgggcttgctcgtgaaatcagatctcggcctccatacactgactacgtc
tccactagatggtacagagctccagaggtgctcctcagatccacatcctacagttcaccc
atagatcagtgggcagtgggctgcatcatggccgagctttacaccctcagacctctgttc
ccaggatccagcgaggtggacaccatattcaagatatgccaagtactgggtacaccaaag
aagacagactggccagagggatatcagctggccagtgccatgaacttccgctggcctcag
tgcgttcccagtaacctgaagactctgatcccaaatgccagcgccgaagccatccatcta
atgaccgacttccttcagtgggatcccaggaagagaccagcttctgcacaggctctcagg
tattcatatttccatgtaggtcaagctttgggcactcctcagcagatcctggagcaggga
cggcctcagcgcagccttgtgcagctccagtcccagcagaacctcctgcagcagcagcag
cagcagcagcctctgctgttgaagcctctgccgccctcccagccccctccaaaccagcac
acttccccctccagacctctccatcagatccagccctcccctgcatcagcaacaaccccg
gccgccgcgtaccagcggcacgcggatctccctcgagagcagcagccaaagcacatcctg
aagcaggaccaactggagacaaccccacagagacaccttccttttattgttgacaacagc
ctgcaacacaagcaaatgaggcaggagccagaaaatgaaaacttactaagttatcagcta
aaggccaaaggaggagggcggcggcgctggggtcagggcgtaggaagcctgaaaggagag
gactgggacgactatgacgaggttgatgtatcgtctattcttggaaaaaacagcttctcc
tctgagaagacgatgcagggagaagacgctctgagcaggtatggaaaagttctggatttc
agtcggcctaatggaaaagaagaagcgccgttaaacctgaacaagactggaccctatcag
gaaccatccagaaccgcctctgctaaacaacactacctgagacagtcgagatttttacct
ggcattagtacaaagaagaatgtggctcaaaatgttagtaaggatcttgcagcaaaccaa
ctttggggtagcagtagtattccatttggaggaactcttccaagcagaggagcttacggt
aaagtccccttcattcctgcatcgtgtagatcctctcgtctgattattgtgacttctttt
tattcagggacaaacacaatccctggtggatacatgccgtcattcagcaaggacagcggc
tctgctggccacagggggcggcagggcgttgctacggaaaccacagcatcaaattatgca
acgtggaggtctggccgaagtcacctgaatgcatctgtcaacacgccgaccgccaacaag
agcacacctggtctgctgccccgccctcccctgcagacaattcacgggcggacagactgg
tcagccaaatacggacaccgttag

DBGET integrated database retrieval system